Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 53792..54056 | Replicon | plasmid pMHMC-003 |
| Accession | NZ_CP053754 | ||
| Organism | Shigella sonnei strain 506 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Y6M3 |
| Locus tag | COO90_RS26460 | Protein ID | WP_001331364.1 |
| Coordinates | 53792..53944 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 53999..54056 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| COO90_RS26430 (49069) | 49069..51237 | + | 2169 | WP_000698357.1 | DotA/TraY family protein | - |
| COO90_RS26435 (51311) | 51311..51961 | + | 651 | WP_001178506.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| COO90_RS26440 (52033) | 52033..52242 | - | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| COO90_RS26445 (52634) | 52634..52810 | + | 177 | WP_001054898.1 | hypothetical protein | - |
| COO90_RS27490 (52875) | 52875..52970 | - | 96 | WP_001303310.1 | DinQ-like type I toxin DqlB | - |
| COO90_RS26455 (53469) | 53469..53720 | + | 252 | WP_001291964.1 | hypothetical protein | - |
| COO90_RS26460 (53792) | 53792..53944 | - | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
| - (53999) | 53999..54056 | + | 58 | NuclAT_0 | - | Antitoxin |
| - (53999) | 53999..54056 | + | 58 | NuclAT_0 | - | Antitoxin |
| - (53999) | 53999..54056 | + | 58 | NuclAT_0 | - | Antitoxin |
| - (53999) | 53999..54056 | + | 58 | NuclAT_0 | - | Antitoxin |
| - (54297) | 54297..54352 | + | 56 | NuclAT_1 | - | - |
| - (54297) | 54297..54352 | + | 56 | NuclAT_1 | - | - |
| - (54297) | 54297..54352 | + | 56 | NuclAT_1 | - | - |
| - (54297) | 54297..54352 | + | 56 | NuclAT_1 | - | - |
| COO90_RS26465 (54546) | 54546..55499 | + | 954 | WP_021513958.1 | hypothetical protein | - |
| COO90_RS26470 (55717) | 55717..56925 | + | 1209 | WP_001383960.1 | IncI1-type conjugal transfer protein TrbA | - |
| COO90_RS26475 (56944) | 56944..58014 | + | 1071 | WP_000151583.1 | IncI1-type conjugal transfer protein TrbB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..88060 | 88060 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T157731 WP_001331364.1 NZ_CP053754:c53944-53792 [Shigella sonnei]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T157731 NZ_CP069451:c4957030-4956923 [Escherichia coli]
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA
Antitoxin
Download Length: 58 bp
>AT157731 NZ_CP053754:53999-54056 [Shigella sonnei]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|