Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 29617..29886 | Replicon | plasmid pCP55-IncFII |
Accession | NZ_CP053734 | ||
Organism | Escherichia coli strain CP55_Sichuan |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | HP431_RS26030 | Protein ID | WP_001312861.1 |
Coordinates | 29728..29886 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 29617..29682 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HP431_RS25995 | 24905..25099 | + | 195 | WP_032175643.1 | hypothetical protein | - |
HP431_RS26000 | 25327..25854 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
HP431_RS26005 | 25912..26145 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
HP431_RS26010 | 26206..28229 | + | 2024 | Protein_38 | ParB/RepB/Spo0J family partition protein | - |
HP431_RS26015 | 28298..28732 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
HP431_RS26020 | 28729..29448 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
- | 29460..29684 | + | 225 | NuclAT_0 | - | - |
- | 29460..29684 | + | 225 | NuclAT_0 | - | - |
- | 29460..29684 | + | 225 | NuclAT_0 | - | - |
- | 29460..29684 | + | 225 | NuclAT_0 | - | - |
HP431_RS26025 | 29469..29648 | - | 180 | WP_001309233.1 | hypothetical protein | - |
- | 29617..29682 | + | 66 | - | - | Antitoxin |
HP431_RS26030 | 29728..29886 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
HP431_RS26035 | 30364..30557 | + | 194 | Protein_43 | hypothetical protein | - |
HP431_RS26040 | 30783..31079 | + | 297 | WP_001272251.1 | hypothetical protein | - |
HP431_RS26045 | 31190..32011 | + | 822 | WP_032237714.1 | DUF945 domain-containing protein | - |
HP431_RS26050 | 32308..32910 | - | 603 | WP_000243713.1 | transglycosylase SLT domain-containing protein | - |
HP431_RS26055 | 33233..33616 | + | 384 | WP_001354030.1 | relaxosome protein TraM | - |
HP431_RS26060 | 33810..34481 | + | 672 | WP_000283561.1 | conjugal transfer transcriptional regulator TraJ | - |
HP431_RS26065 | 34618..34845 | + | 228 | WP_000089263.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | mcr-3.5 / mph(A) | - | 1..70770 | 70770 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T157649 WP_001312861.1 NZ_CP053734:29728-29886 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T157649 NZ_CP069441:c2327415-2327308 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAGCTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAGCTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 66 bp
>AT157649 NZ_CP053734:29617-29682 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|