Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 709829..710049 Replicon chromosome
Accession NZ_CP053731
Organism Escherichia coli strain CP55_Sichuan

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag HP431_RS03450 Protein ID WP_000170965.1
Coordinates 709942..710049 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 709829..709895 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HP431_RS03425 705108..706502 - 1395 WP_000086201.1 inverse autotransporter invasin YchO -
HP431_RS03430 706687..707040 + 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
HP431_RS03435 707084..707779 - 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
HP431_RS03440 707937..708167 - 231 WP_001146442.1 putative cation transport regulator ChaB -
HP431_RS03445 708437..709537 + 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
- 709829..709895 - 67 - - Antitoxin
HP431_RS03450 709942..710049 + 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 710362..710425 - 64 NuclAT_34 - -
- 710362..710425 - 64 NuclAT_34 - -
- 710362..710425 - 64 NuclAT_34 - -
- 710362..710425 - 64 NuclAT_34 - -
- 710362..710425 - 64 NuclAT_37 - -
- 710362..710425 - 64 NuclAT_37 - -
- 710362..710425 - 64 NuclAT_37 - -
- 710362..710425 - 64 NuclAT_37 - -
- 710362..710425 - 64 NuclAT_40 - -
- 710362..710425 - 64 NuclAT_40 - -
- 710362..710425 - 64 NuclAT_40 - -
- 710362..710425 - 64 NuclAT_40 - -
- 710362..710425 - 64 NuclAT_43 - -
- 710362..710425 - 64 NuclAT_43 - -
- 710362..710425 - 64 NuclAT_43 - -
- 710362..710425 - 64 NuclAT_43 - -
- 710362..710425 - 64 NuclAT_46 - -
- 710362..710425 - 64 NuclAT_46 - -
- 710362..710425 - 64 NuclAT_46 - -
- 710362..710425 - 64 NuclAT_46 - -
- 710362..710425 - 64 NuclAT_49 - -
- 710362..710425 - 64 NuclAT_49 - -
- 710362..710425 - 64 NuclAT_49 - -
- 710362..710425 - 64 NuclAT_49 - -
- 710363..710425 - 63 NuclAT_51 - -
- 710363..710425 - 63 NuclAT_51 - -
- 710363..710425 - 63 NuclAT_51 - -
- 710363..710425 - 63 NuclAT_51 - -
- 710363..710425 - 63 NuclAT_54 - -
- 710363..710425 - 63 NuclAT_54 - -
- 710363..710425 - 63 NuclAT_54 - -
- 710363..710425 - 63 NuclAT_54 - -
- 710363..710425 - 63 NuclAT_57 - -
- 710363..710425 - 63 NuclAT_57 - -
- 710363..710425 - 63 NuclAT_57 - -
- 710363..710425 - 63 NuclAT_57 - -
- 710364..710425 - 62 NuclAT_16 - -
- 710364..710425 - 62 NuclAT_16 - -
- 710364..710425 - 62 NuclAT_16 - -
- 710364..710425 - 62 NuclAT_16 - -
- 710364..710425 - 62 NuclAT_19 - -
- 710364..710425 - 62 NuclAT_19 - -
- 710364..710425 - 62 NuclAT_19 - -
- 710364..710425 - 62 NuclAT_19 - -
- 710364..710425 - 62 NuclAT_22 - -
- 710364..710425 - 62 NuclAT_22 - -
- 710364..710425 - 62 NuclAT_22 - -
- 710364..710425 - 62 NuclAT_22 - -
- 710364..710425 - 62 NuclAT_25 - -
- 710364..710425 - 62 NuclAT_25 - -
- 710364..710425 - 62 NuclAT_25 - -
- 710364..710425 - 62 NuclAT_25 - -
- 710364..710425 - 62 NuclAT_28 - -
- 710364..710425 - 62 NuclAT_28 - -
- 710364..710425 - 62 NuclAT_28 - -
- 710364..710425 - 62 NuclAT_28 - -
- 710364..710425 - 62 NuclAT_31 - -
- 710364..710425 - 62 NuclAT_31 - -
- 710364..710425 - 62 NuclAT_31 - -
- 710364..710425 - 62 NuclAT_31 - -
HP431_RS03455 710478..710585 + 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 710898..710963 - 66 NuclAT_33 - -
- 710898..710963 - 66 NuclAT_33 - -
- 710898..710963 - 66 NuclAT_33 - -
- 710898..710963 - 66 NuclAT_33 - -
- 710898..710963 - 66 NuclAT_36 - -
- 710898..710963 - 66 NuclAT_36 - -
- 710898..710963 - 66 NuclAT_36 - -
- 710898..710963 - 66 NuclAT_36 - -
- 710898..710963 - 66 NuclAT_39 - -
- 710898..710963 - 66 NuclAT_39 - -
- 710898..710963 - 66 NuclAT_39 - -
- 710898..710963 - 66 NuclAT_39 - -
- 710898..710963 - 66 NuclAT_42 - -
- 710898..710963 - 66 NuclAT_42 - -
- 710898..710963 - 66 NuclAT_42 - -
- 710898..710963 - 66 NuclAT_42 - -
- 710898..710963 - 66 NuclAT_45 - -
- 710898..710963 - 66 NuclAT_45 - -
- 710898..710963 - 66 NuclAT_45 - -
- 710898..710963 - 66 NuclAT_45 - -
- 710898..710963 - 66 NuclAT_48 - -
- 710898..710963 - 66 NuclAT_48 - -
- 710898..710963 - 66 NuclAT_48 - -
- 710898..710963 - 66 NuclAT_48 - -
- 710899..710965 - 67 NuclAT_50 - -
- 710899..710965 - 67 NuclAT_50 - -
- 710899..710965 - 67 NuclAT_50 - -
- 710899..710965 - 67 NuclAT_50 - -
- 710899..710965 - 67 NuclAT_53 - -
- 710899..710965 - 67 NuclAT_53 - -
- 710899..710965 - 67 NuclAT_53 - -
- 710899..710965 - 67 NuclAT_53 - -
- 710899..710965 - 67 NuclAT_56 - -
- 710899..710965 - 67 NuclAT_56 - -
- 710899..710965 - 67 NuclAT_56 - -
- 710899..710965 - 67 NuclAT_56 - -
- 710900..710963 - 64 NuclAT_15 - -
- 710900..710963 - 64 NuclAT_15 - -
- 710900..710963 - 64 NuclAT_15 - -
- 710900..710963 - 64 NuclAT_15 - -
- 710900..710963 - 64 NuclAT_18 - -
- 710900..710963 - 64 NuclAT_18 - -
- 710900..710963 - 64 NuclAT_18 - -
- 710900..710963 - 64 NuclAT_18 - -
- 710900..710963 - 64 NuclAT_21 - -
- 710900..710963 - 64 NuclAT_21 - -
- 710900..710963 - 64 NuclAT_21 - -
- 710900..710963 - 64 NuclAT_21 - -
- 710900..710963 - 64 NuclAT_24 - -
- 710900..710963 - 64 NuclAT_24 - -
- 710900..710963 - 64 NuclAT_24 - -
- 710900..710963 - 64 NuclAT_24 - -
- 710900..710963 - 64 NuclAT_27 - -
- 710900..710963 - 64 NuclAT_27 - -
- 710900..710963 - 64 NuclAT_27 - -
- 710900..710963 - 64 NuclAT_27 - -
- 710900..710963 - 64 NuclAT_30 - -
- 710900..710963 - 64 NuclAT_30 - -
- 710900..710963 - 64 NuclAT_30 - -
- 710900..710963 - 64 NuclAT_30 - -
HP431_RS03460 711013..711120 + 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
HP431_RS03465 711269..712123 - 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
HP431_RS03470 712159..712968 - 810 WP_001257044.1 invasion regulator SirB1 -
HP431_RS03475 712972..713364 - 393 WP_000200392.1 invasion regulator SirB2 -
HP431_RS03480 713361..714194 - 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T157625 WP_000170965.1 NZ_CP053731:709942-710049 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T157625 NZ_CP069438:c1875745-1875338 [Escherichia coli]
GTGGTCCTGTGGCAATCTGATTTGCGCGTCTCCTGGCGCGCGCAGTGGCTTTCCTTGCTGATCCACGGGCTGGTTGCCGC
TGTTATTTTACTCATGCCCTGGCCGCTCAGTTACACCCCGTTATGGATGGTGTTACTTTCGCTGGTGGTGTTTGATTGCG
TTCGCAGCCAGCGACGCATTAATGCTCGCCAGGGGGAAATTCGCCTGTTGATGGACGGGCGTTTGCGTTGGCAAGGGCAG
GAGTGGAGCATCGTCAAAGCGCCGTGGATGATTAAGAGCGGCATGATGCTGCGTTTACGTTCTGACAGCGGAAAACGGCA
ACATTTATGGCTGGCAGCTGACAGCATGGACGAAGCCGAATGGCGGGATTTACGGCGGATATTGTTACAACAAGAGACGC
AAAGATAA

Antitoxin


Download         Length: 67 bp

>AT157625 NZ_CP053731:c709895-709829 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References