Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 53357..53626 | Replicon | plasmid pCP66-6-IncFII |
Accession | NZ_CP053725 | ||
Organism | Escherichia coli strain CP66-6_Sichuan |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | HP433_RS23995 | Protein ID | WP_001312861.1 |
Coordinates | 53468..53626 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 53357..53422 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HP433_RS23955 | 48702..48890 | + | 189 | WP_032146593.1 | hypothetical protein | - |
HP433_RS23960 | 48892..49098 | + | 207 | WP_000275858.1 | hypothetical protein | - |
HP433_RS23965 | 49124..49663 | + | 540 | WP_001825195.1 | single-stranded DNA-binding protein | - |
HP433_RS23970 | 49726..49959 | + | 234 | WP_000005990.1 | DUF905 family protein | - |
HP433_RS23975 | 50025..51983 | + | 1959 | WP_001825193.1 | ParB/RepB/Spo0J family partition protein | - |
HP433_RS23980 | 52038..52472 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
HP433_RS23985 | 52469..53188 | + | 720 | WP_013362833.1 | plasmid SOS inhibition protein A | - |
HP433_RS23990 | 53200..53388 | - | 189 | WP_001299721.1 | hypothetical protein | - |
- | 53200..53424 | + | 225 | NuclAT_0 | - | - |
- | 53200..53424 | + | 225 | NuclAT_0 | - | - |
- | 53200..53424 | + | 225 | NuclAT_0 | - | - |
- | 53200..53424 | + | 225 | NuclAT_0 | - | - |
- | 53357..53422 | + | 66 | - | - | Antitoxin |
HP433_RS23995 | 53468..53626 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
HP433_RS24000 | 54127..54315 | + | 189 | WP_042111937.1 | hypothetical protein | - |
HP433_RS24005 | 54548..54835 | + | 288 | WP_000107544.1 | hypothetical protein | - |
HP433_RS24010 | 54956..55777 | + | 822 | WP_172615468.1 | DUF945 domain-containing protein | - |
HP433_RS24015 | 56074..56721 | - | 648 | WP_031943493.1 | transglycosylase SLT domain-containing protein | - |
HP433_RS24020 | 56998..57381 | + | 384 | WP_000124981.1 | relaxosome protein TraM | - |
HP433_RS24025 | 57572..58258 | + | 687 | WP_000332484.1 | PAS domain-containing protein | - |
HP433_RS24030 | 58352..58579 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | dfrA12 / mph(A) / fosA3 / blaTEM-215 / mcr-3.5 | - | 1..74817 | 74817 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T157584 WP_001312861.1 NZ_CP053725:53468-53626 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T157584 NZ_CP069386:c275951-275664 [Escherichia coli]
ATGGCGTATTTTCTGGATTTTGACGAGCGGGCACTAAAGGAATGGCGAAAGCTGGGCTCGACGGTACGTGAACAGTTGAA
AAAGAAGCTGGTTGAAGTACTTGAGTCACCCCGGATTGAAGCAAACAAGCTCCGTGGTATGCCTGATTGTTACAAGATTA
AGCTCCGGTCTTCAGGCTATCGCCTTGTATACCAGGTTATAGACGAGAAAGTTGTCGTTTTCGTGATTTCTGTTGGGAAA
AGAGAACGCTCGGAAGTATATAGCGAGGCGGTCAAACGCATTCTCTGA
ATGGCGTATTTTCTGGATTTTGACGAGCGGGCACTAAAGGAATGGCGAAAGCTGGGCTCGACGGTACGTGAACAGTTGAA
AAAGAAGCTGGTTGAAGTACTTGAGTCACCCCGGATTGAAGCAAACAAGCTCCGTGGTATGCCTGATTGTTACAAGATTA
AGCTCCGGTCTTCAGGCTATCGCCTTGTATACCAGGTTATAGACGAGAAAGTTGTCGTTTTCGTGATTTCTGTTGGGAAA
AGAGAACGCTCGGAAGTATATAGCGAGGCGGTCAAACGCATTCTCTGA
Antitoxin
Download Length: 66 bp
>AT157584 NZ_CP053725:53357-53422 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|