Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 59213..59467 | Replicon | plasmid pCP66-6-IncFIC |
Accession | NZ_CP053724 | ||
Organism | Escherichia coli strain CP66-6_Sichuan |
Toxin (Protein)
Gene name | srnB | Uniprot ID | - |
Locus tag | HP433_RS23440 | Protein ID | WP_001351576.1 |
Coordinates | 59213..59419 (-) | Length | 69 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 59406..59467 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HP433_RS23405 | 55234..55734 | + | 501 | Protein_64 | Tn3 family transposase | - |
HP433_RS23410 | 55768..55956 | + | 189 | Protein_65 | transposase | - |
HP433_RS23415 | 56031..56318 | - | 288 | WP_000222766.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
HP433_RS23420 | 56315..56566 | - | 252 | WP_001132900.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
HP433_RS23425 | 57532..58389 | - | 858 | WP_039002220.1 | incFII family plasmid replication initiator RepA | - |
HP433_RS23430 | 58382..58456 | - | 75 | WP_061357229.1 | RepA leader peptide Tap | - |
HP433_RS23435 | 58688..58945 | - | 258 | WP_001541895.1 | replication regulatory protein RepA | - |
HP433_RS23440 | 59213..59419 | - | 207 | WP_001351576.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 59406..59467 | + | 62 | NuclAT_1 | - | Antitoxin |
- | 59406..59467 | + | 62 | NuclAT_1 | - | Antitoxin |
- | 59406..59467 | + | 62 | NuclAT_1 | - | Antitoxin |
- | 59406..59467 | + | 62 | NuclAT_1 | - | Antitoxin |
HP433_RS23445 | 59809..60021 | - | 213 | WP_001541896.1 | ANR family transcriptional regulator | - |
HP433_RS23450 | 60156..60566 | - | 411 | Protein_73 | fertility inhibition protein FinO | - |
HP433_RS23455 | 60569..63454 | - | 2886 | Protein_74 | conjugative transfer relaxase/helicase TraI | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | tet(M) / ant(3'')-Ia / cmlA1 / aadA2 / dfrA12 / floR / sul2 / tet(A) / aph(3')-Ia / sul3 / blaTEM-215 / lnu(F) / aac(3)-IId | - | 1..99734 | 99734 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 69 a.a. Molecular weight: 7826.31 Da Isoelectric Point: 8.8807
>T157574 WP_001351576.1 NZ_CP053724:c59419-59213 [Escherichia coli]
MKYLNTTDCSLFFAERSKFMTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MKYLNTTDCSLFFAERSKFMTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 207 bp
>T157574 NZ_CP069381:3442357-3442575 [Salmonella enterica]
ATGTCTGATAAACCATTAACTAAAACTGATTATTTGATGCGTTTACGGCGCTGTCAGACAATTGACACTCTGGAGCGCGT
CATTGAGAAAAATAAATATGAATTGTCCGACAATGAGCTGGCTGTATTTTACTCAGCTGCGGATCACCGTCTTGCAGAAT
TGACGATGAACAAACTCTACGACAAGATCCCCTCTTCAGTATGGAAATTCATTCGTTAA
ATGTCTGATAAACCATTAACTAAAACTGATTATTTGATGCGTTTACGGCGCTGTCAGACAATTGACACTCTGGAGCGCGT
CATTGAGAAAAATAAATATGAATTGTCCGACAATGAGCTGGCTGTATTTTACTCAGCTGCGGATCACCGTCTTGCAGAAT
TGACGATGAACAAACTCTACGACAAGATCCCCTCTTCAGTATGGAAATTCATTCGTTAA
Antitoxin
Download Length: 62 bp
>AT157574 NZ_CP053724:59406-59467 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|