Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2405488..2405672 | Replicon | chromosome |
Accession | NZ_CP053640 | ||
Organism | Staphylococcus aureus strain 14505 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2U0ISP5 |
Locus tag | HA033_RS11860 | Protein ID | WP_000482652.1 |
Coordinates | 2405488..2405595 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2405612..2405672 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HA033_RS11835 | 2400850..2401323 | + | 474 | WP_000456486.1 | GyrI-like domain-containing protein | - |
HA033_RS11840 | 2401446..2402657 | - | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
HA033_RS11845 | 2402839..2403498 | - | 660 | WP_000831298.1 | membrane protein | - |
HA033_RS11850 | 2403558..2404700 | - | 1143 | WP_001176863.1 | glycerate kinase | - |
HA033_RS11855 | 2404968..2405354 | + | 387 | WP_000779360.1 | flippase GtxA | - |
HA033_RS11860 | 2405488..2405595 | + | 108 | WP_000482652.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 2405612..2405672 | - | 61 | - | - | Antitoxin |
HA033_RS11865 | 2406298..2408061 | + | 1764 | WP_001064825.1 | ABC transporter ATP-binding protein/permease | - |
HA033_RS11870 | 2408086..2409819 | + | 1734 | WP_000486487.1 | ABC transporter ATP-binding protein/permease | - |
HA033_RS11875 | 2410050..2410217 | + | 168 | Protein_2306 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T157315 WP_000482652.1 NZ_CP053640:2405488-2405595 [Staphylococcus aureus]
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T157315 NZ_CP069133:c3693447-3693340 [Escherichia coli BW25113]
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 61 bp
>AT157315 NZ_CP053640:c2405672-2405612 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|