Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 2625381..2625563 | Replicon | chromosome |
| Accession | NZ_CP053639 | ||
| Organism | Staphylococcus aureus strain 14732 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | HA036_RS13030 | Protein ID | WP_001801861.1 |
| Coordinates | 2625381..2625476 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 2625504..2625563 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HA036_RS12990 | 2621041..2621667 | + | 627 | WP_000669046.1 | hypothetical protein | - |
| HA036_RS12995 | 2621708..2622052 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
| HA036_RS13000 | 2622150..2622701 | + | 552 | WP_000414205.1 | hypothetical protein | - |
| HA036_RS13005 | 2622919..2623560 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| HA036_RS13010 | 2623674..2623859 | - | 186 | WP_000809857.1 | hypothetical protein | - |
| HA036_RS13015 | 2623861..2624037 | - | 177 | WP_000375476.1 | hypothetical protein | - |
| HA036_RS13020 | 2624048..2624431 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| HA036_RS13025 | 2625035..2625178 | - | 144 | WP_001549059.1 | transposase | - |
| HA036_RS13030 | 2625381..2625476 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 2625504..2625563 | - | 60 | - | - | Antitoxin |
| HA036_RS13035 | 2625599..2625700 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| HA036_RS13040 | 2625678..2625854 | - | 177 | Protein_2531 | transposase | - |
| HA036_RS13045 | 2626048..2626425 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2620343..2620828 | 485 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T157298 WP_001801861.1 NZ_CP053639:2625381-2625476 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T157298 NZ_CP069133:c1265266-1265159 [Escherichia coli BW25113]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 60 bp
>AT157298 NZ_CP053639:c2625563-2625504 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|