Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2270558..2270742 | Replicon | chromosome |
Accession | NZ_CP053634 | ||
Organism | Staphylococcus aureus strain 14638 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2U0ISP5 |
Locus tag | HA038_RS11205 | Protein ID | WP_000482652.1 |
Coordinates | 2270558..2270665 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2270682..2270742 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HA038_RS11180 | 2265920..2266393 | + | 474 | WP_000456486.1 | GyrI-like domain-containing protein | - |
HA038_RS11185 | 2266516..2267727 | - | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
HA038_RS11190 | 2267909..2268568 | - | 660 | WP_000831298.1 | membrane protein | - |
HA038_RS11195 | 2268628..2269770 | - | 1143 | WP_001176863.1 | glycerate kinase | - |
HA038_RS11200 | 2270038..2270424 | + | 387 | WP_000779360.1 | flippase GtxA | - |
HA038_RS11205 | 2270558..2270665 | + | 108 | WP_000482652.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 2270682..2270742 | - | 61 | - | - | Antitoxin |
HA038_RS11210 | 2271368..2273131 | + | 1764 | WP_001064825.1 | ABC transporter ATP-binding protein/permease | - |
HA038_RS11215 | 2273156..2274889 | + | 1734 | WP_000486487.1 | ABC transporter ATP-binding protein/permease | - |
HA038_RS11220 | 2275120..2275287 | + | 168 | Protein_2178 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T157259 WP_000482652.1 NZ_CP053634:2270558-2270665 [Staphylococcus aureus]
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T157259 NZ_CP069084:c4559394-4559260 [Xanthomonas campestris pv. campestris]
ATGAAGCGTGCAATTGCATTGTTGGTGCTGTCGATGTTGTCGGTTGGAATGCTGGCGGGTTGCAACACCGTCGCAGGTGC
CGGCAAGGACGTGCAGGGCGCTGGCGAGAAGGTGGAAGACGCCGCGCGCAAGTGA
ATGAAGCGTGCAATTGCATTGTTGGTGCTGTCGATGTTGTCGGTTGGAATGCTGGCGGGTTGCAACACCGTCGCAGGTGC
CGGCAAGGACGTGCAGGGCGCTGGCGAGAAGGTGGAAGACGCCGCGCGCAAGTGA
Antitoxin
Download Length: 61 bp
>AT157259 NZ_CP053634:c2270742-2270682 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|