Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 1258612..1258832 | Replicon | chromosome |
Accession | NZ_CP053602 | ||
Organism | Escherichia coli BL21(DE3) |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | E3PKK3 |
Locus tag | HO396_RS06195 | Protein ID | WP_000170951.1 |
Coordinates | 1258612..1258719 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 1258769..1258832 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HO396_RS06170 | 1254458..1255540 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
HO396_RS06175 | 1255540..1256373 | + | 834 | WP_000456454.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
HO396_RS06180 | 1256370..1256762 | + | 393 | WP_000200373.1 | invasion regulator SirB2 | - |
HO396_RS06185 | 1256766..1257575 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
HO396_RS06190 | 1257611..1258465 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
HO396_RS06195 | 1258612..1258719 | - | 108 | WP_000170951.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 1258769..1258832 | + | 64 | NuclAT_32 | - | Antitoxin |
- | 1258769..1258832 | + | 64 | NuclAT_32 | - | Antitoxin |
- | 1258769..1258832 | + | 64 | NuclAT_32 | - | Antitoxin |
- | 1258769..1258832 | + | 64 | NuclAT_32 | - | Antitoxin |
- | 1258769..1258832 | + | 64 | NuclAT_35 | - | Antitoxin |
- | 1258769..1258832 | + | 64 | NuclAT_35 | - | Antitoxin |
- | 1258769..1258832 | + | 64 | NuclAT_35 | - | Antitoxin |
- | 1258769..1258832 | + | 64 | NuclAT_35 | - | Antitoxin |
- | 1258769..1258832 | + | 64 | NuclAT_38 | - | Antitoxin |
- | 1258769..1258832 | + | 64 | NuclAT_38 | - | Antitoxin |
- | 1258769..1258832 | + | 64 | NuclAT_38 | - | Antitoxin |
- | 1258769..1258832 | + | 64 | NuclAT_38 | - | Antitoxin |
- | 1258769..1258832 | + | 64 | NuclAT_41 | - | Antitoxin |
- | 1258769..1258832 | + | 64 | NuclAT_41 | - | Antitoxin |
- | 1258769..1258832 | + | 64 | NuclAT_41 | - | Antitoxin |
- | 1258769..1258832 | + | 64 | NuclAT_41 | - | Antitoxin |
- | 1258769..1258832 | + | 64 | NuclAT_47 | - | Antitoxin |
- | 1258769..1258832 | + | 64 | NuclAT_47 | - | Antitoxin |
- | 1258769..1258832 | + | 64 | NuclAT_47 | - | Antitoxin |
- | 1258769..1258832 | + | 64 | NuclAT_47 | - | Antitoxin |
- | 1258769..1258832 | + | 64 | NuclAT_50 | - | Antitoxin |
- | 1258769..1258832 | + | 64 | NuclAT_50 | - | Antitoxin |
- | 1258769..1258832 | + | 64 | NuclAT_50 | - | Antitoxin |
- | 1258769..1258832 | + | 64 | NuclAT_50 | - | Antitoxin |
HO396_RS06200 | 1259147..1259254 | - | 108 | WP_000170963.1 | small toxic polypeptide LdrB | - |
- | 1259302..1259367 | + | 66 | NuclAT_30 | - | - |
- | 1259302..1259367 | + | 66 | NuclAT_30 | - | - |
- | 1259302..1259367 | + | 66 | NuclAT_30 | - | - |
- | 1259302..1259367 | + | 66 | NuclAT_30 | - | - |
- | 1259302..1259367 | + | 66 | NuclAT_33 | - | - |
- | 1259302..1259367 | + | 66 | NuclAT_33 | - | - |
- | 1259302..1259367 | + | 66 | NuclAT_33 | - | - |
- | 1259302..1259367 | + | 66 | NuclAT_33 | - | - |
- | 1259302..1259367 | + | 66 | NuclAT_36 | - | - |
- | 1259302..1259367 | + | 66 | NuclAT_36 | - | - |
- | 1259302..1259367 | + | 66 | NuclAT_36 | - | - |
- | 1259302..1259367 | + | 66 | NuclAT_36 | - | - |
- | 1259302..1259367 | + | 66 | NuclAT_39 | - | - |
- | 1259302..1259367 | + | 66 | NuclAT_39 | - | - |
- | 1259302..1259367 | + | 66 | NuclAT_39 | - | - |
- | 1259302..1259367 | + | 66 | NuclAT_39 | - | - |
- | 1259302..1259367 | + | 66 | NuclAT_45 | - | - |
- | 1259302..1259367 | + | 66 | NuclAT_45 | - | - |
- | 1259302..1259367 | + | 66 | NuclAT_45 | - | - |
- | 1259302..1259367 | + | 66 | NuclAT_45 | - | - |
- | 1259302..1259367 | + | 66 | NuclAT_48 | - | - |
- | 1259302..1259367 | + | 66 | NuclAT_48 | - | - |
- | 1259302..1259367 | + | 66 | NuclAT_48 | - | - |
- | 1259302..1259367 | + | 66 | NuclAT_48 | - | - |
- | 1259302..1259369 | + | 68 | NuclAT_16 | - | - |
- | 1259302..1259369 | + | 68 | NuclAT_16 | - | - |
- | 1259302..1259369 | + | 68 | NuclAT_16 | - | - |
- | 1259302..1259369 | + | 68 | NuclAT_16 | - | - |
- | 1259302..1259369 | + | 68 | NuclAT_18 | - | - |
- | 1259302..1259369 | + | 68 | NuclAT_18 | - | - |
- | 1259302..1259369 | + | 68 | NuclAT_18 | - | - |
- | 1259302..1259369 | + | 68 | NuclAT_18 | - | - |
- | 1259302..1259369 | + | 68 | NuclAT_20 | - | - |
- | 1259302..1259369 | + | 68 | NuclAT_20 | - | - |
- | 1259302..1259369 | + | 68 | NuclAT_20 | - | - |
- | 1259302..1259369 | + | 68 | NuclAT_20 | - | - |
- | 1259302..1259369 | + | 68 | NuclAT_22 | - | - |
- | 1259302..1259369 | + | 68 | NuclAT_22 | - | - |
- | 1259302..1259369 | + | 68 | NuclAT_22 | - | - |
- | 1259302..1259369 | + | 68 | NuclAT_22 | - | - |
- | 1259302..1259369 | + | 68 | NuclAT_24 | - | - |
- | 1259302..1259369 | + | 68 | NuclAT_24 | - | - |
- | 1259302..1259369 | + | 68 | NuclAT_24 | - | - |
- | 1259302..1259369 | + | 68 | NuclAT_24 | - | - |
- | 1259302..1259369 | + | 68 | NuclAT_26 | - | - |
- | 1259302..1259369 | + | 68 | NuclAT_26 | - | - |
- | 1259302..1259369 | + | 68 | NuclAT_26 | - | - |
- | 1259302..1259369 | + | 68 | NuclAT_26 | - | - |
HO396_RS06205 | 1259682..1259789 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- | 1259837..1259902 | + | 66 | NuclAT_31 | - | - |
- | 1259837..1259902 | + | 66 | NuclAT_31 | - | - |
- | 1259837..1259902 | + | 66 | NuclAT_31 | - | - |
- | 1259837..1259902 | + | 66 | NuclAT_31 | - | - |
- | 1259837..1259902 | + | 66 | NuclAT_34 | - | - |
- | 1259837..1259902 | + | 66 | NuclAT_34 | - | - |
- | 1259837..1259902 | + | 66 | NuclAT_34 | - | - |
- | 1259837..1259902 | + | 66 | NuclAT_34 | - | - |
- | 1259837..1259902 | + | 66 | NuclAT_37 | - | - |
- | 1259837..1259902 | + | 66 | NuclAT_37 | - | - |
- | 1259837..1259902 | + | 66 | NuclAT_37 | - | - |
- | 1259837..1259902 | + | 66 | NuclAT_37 | - | - |
- | 1259837..1259902 | + | 66 | NuclAT_40 | - | - |
- | 1259837..1259902 | + | 66 | NuclAT_40 | - | - |
- | 1259837..1259902 | + | 66 | NuclAT_40 | - | - |
- | 1259837..1259902 | + | 66 | NuclAT_40 | - | - |
- | 1259837..1259902 | + | 66 | NuclAT_46 | - | - |
- | 1259837..1259902 | + | 66 | NuclAT_46 | - | - |
- | 1259837..1259902 | + | 66 | NuclAT_46 | - | - |
- | 1259837..1259902 | + | 66 | NuclAT_46 | - | - |
- | 1259837..1259902 | + | 66 | NuclAT_49 | - | - |
- | 1259837..1259902 | + | 66 | NuclAT_49 | - | - |
- | 1259837..1259902 | + | 66 | NuclAT_49 | - | - |
- | 1259837..1259902 | + | 66 | NuclAT_49 | - | - |
- | 1259837..1259904 | + | 68 | NuclAT_15 | - | - |
- | 1259837..1259904 | + | 68 | NuclAT_15 | - | - |
- | 1259837..1259904 | + | 68 | NuclAT_15 | - | - |
- | 1259837..1259904 | + | 68 | NuclAT_15 | - | - |
- | 1259837..1259904 | + | 68 | NuclAT_17 | - | - |
- | 1259837..1259904 | + | 68 | NuclAT_17 | - | - |
- | 1259837..1259904 | + | 68 | NuclAT_17 | - | - |
- | 1259837..1259904 | + | 68 | NuclAT_17 | - | - |
- | 1259837..1259904 | + | 68 | NuclAT_19 | - | - |
- | 1259837..1259904 | + | 68 | NuclAT_19 | - | - |
- | 1259837..1259904 | + | 68 | NuclAT_19 | - | - |
- | 1259837..1259904 | + | 68 | NuclAT_19 | - | - |
- | 1259837..1259904 | + | 68 | NuclAT_21 | - | - |
- | 1259837..1259904 | + | 68 | NuclAT_21 | - | - |
- | 1259837..1259904 | + | 68 | NuclAT_21 | - | - |
- | 1259837..1259904 | + | 68 | NuclAT_21 | - | - |
- | 1259837..1259904 | + | 68 | NuclAT_23 | - | - |
- | 1259837..1259904 | + | 68 | NuclAT_23 | - | - |
- | 1259837..1259904 | + | 68 | NuclAT_23 | - | - |
- | 1259837..1259904 | + | 68 | NuclAT_23 | - | - |
- | 1259837..1259904 | + | 68 | NuclAT_25 | - | - |
- | 1259837..1259904 | + | 68 | NuclAT_25 | - | - |
- | 1259837..1259904 | + | 68 | NuclAT_25 | - | - |
- | 1259837..1259904 | + | 68 | NuclAT_25 | - | - |
HO396_RS06210 | 1260194..1261294 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
HO396_RS06215 | 1261564..1261794 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
HO396_RS06220 | 1261952..1262647 | + | 696 | WP_012775986.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
HO396_RS06225 | 1262691..1263044 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3961.74 Da Isoelectric Point: 9.1413
>T157027 WP_000170951.1 NZ_CP053602:c1258719-1258612 [Escherichia coli BL21(DE3)]
MTLAQFAMIFWDDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMIFWDDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T157027 NZ_CP069075:c761698-761390 [Mycobacterium tuberculosis]
ATGCGGCGCGGTGAATTGTGGTTTGCCGCCACACCTGGTGGTGACAGACCAGTACTTGTCCTTACCAGAGATCCGGTGGC
AGACCGCATCGGCGCGGTCGTTGTGGTGGCCCTAACCCGCACCCGCCGAGGCCTGGTGTCGGAATTGGAGCTCACGGCCG
TCGAAAACCGTGTTCCGAGCGACTGCGTCGTCAACTTCGACAACATTCATACGTTGCCACGCACCGCATTCCGACGCCGC
ATCACCCGGCTGTCCCCGGCCCGCCTGCACGAAGCCTGTCAAACACTCCGGGCGAGCACGGGGTGTTGA
ATGCGGCGCGGTGAATTGTGGTTTGCCGCCACACCTGGTGGTGACAGACCAGTACTTGTCCTTACCAGAGATCCGGTGGC
AGACCGCATCGGCGCGGTCGTTGTGGTGGCCCTAACCCGCACCCGCCGAGGCCTGGTGTCGGAATTGGAGCTCACGGCCG
TCGAAAACCGTGTTCCGAGCGACTGCGTCGTCAACTTCGACAACATTCATACGTTGCCACGCACCGCATTCCGACGCCGC
ATCACCCGGCTGTCCCCGGCCCGCCTGCACGAAGCCTGTCAAACACTCCGGGCGAGCACGGGGTGTTGA
Antitoxin
Download Length: 64 bp
>AT157027 NZ_CP053602:1258769-1258832 [Escherichia coli BL21(DE3)]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGATTTTCT
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGATTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|