Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1227776..1227996 Replicon chromosome
Accession NZ_CP053601
Organism Escherichia coli BL21

Toxin (Protein)


Gene name ldrD Uniprot ID E3PKK3
Locus tag HO397_RS05995 Protein ID WP_000170951.1
Coordinates 1227776..1227883 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1227933..1227996 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HO397_RS05970 1223622..1224704 + 1083 WP_000804726.1 peptide chain release factor 1 -
HO397_RS05975 1224704..1225537 + 834 WP_000456454.1 peptide chain release factor N(5)-glutamine methyltransferase -
HO397_RS05980 1225534..1225926 + 393 WP_000200373.1 invasion regulator SirB2 -
HO397_RS05985 1225930..1226739 + 810 WP_001257044.1 invasion regulator SirB1 -
HO397_RS05990 1226775..1227629 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
HO397_RS05995 1227776..1227883 - 108 WP_000170951.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1227933..1227996 + 64 NuclAT_32 - Antitoxin
- 1227933..1227996 + 64 NuclAT_32 - Antitoxin
- 1227933..1227996 + 64 NuclAT_32 - Antitoxin
- 1227933..1227996 + 64 NuclAT_32 - Antitoxin
- 1227933..1227996 + 64 NuclAT_35 - Antitoxin
- 1227933..1227996 + 64 NuclAT_35 - Antitoxin
- 1227933..1227996 + 64 NuclAT_35 - Antitoxin
- 1227933..1227996 + 64 NuclAT_35 - Antitoxin
- 1227933..1227996 + 64 NuclAT_38 - Antitoxin
- 1227933..1227996 + 64 NuclAT_38 - Antitoxin
- 1227933..1227996 + 64 NuclAT_38 - Antitoxin
- 1227933..1227996 + 64 NuclAT_38 - Antitoxin
- 1227933..1227996 + 64 NuclAT_41 - Antitoxin
- 1227933..1227996 + 64 NuclAT_41 - Antitoxin
- 1227933..1227996 + 64 NuclAT_41 - Antitoxin
- 1227933..1227996 + 64 NuclAT_41 - Antitoxin
- 1227933..1227996 + 64 NuclAT_47 - Antitoxin
- 1227933..1227996 + 64 NuclAT_47 - Antitoxin
- 1227933..1227996 + 64 NuclAT_47 - Antitoxin
- 1227933..1227996 + 64 NuclAT_47 - Antitoxin
- 1227933..1227996 + 64 NuclAT_50 - Antitoxin
- 1227933..1227996 + 64 NuclAT_50 - Antitoxin
- 1227933..1227996 + 64 NuclAT_50 - Antitoxin
- 1227933..1227996 + 64 NuclAT_50 - Antitoxin
HO397_RS06000 1228311..1228418 - 108 WP_000170963.1 small toxic polypeptide LdrB -
- 1228466..1228531 + 66 NuclAT_30 - -
- 1228466..1228531 + 66 NuclAT_30 - -
- 1228466..1228531 + 66 NuclAT_30 - -
- 1228466..1228531 + 66 NuclAT_30 - -
- 1228466..1228531 + 66 NuclAT_33 - -
- 1228466..1228531 + 66 NuclAT_33 - -
- 1228466..1228531 + 66 NuclAT_33 - -
- 1228466..1228531 + 66 NuclAT_33 - -
- 1228466..1228531 + 66 NuclAT_36 - -
- 1228466..1228531 + 66 NuclAT_36 - -
- 1228466..1228531 + 66 NuclAT_36 - -
- 1228466..1228531 + 66 NuclAT_36 - -
- 1228466..1228531 + 66 NuclAT_39 - -
- 1228466..1228531 + 66 NuclAT_39 - -
- 1228466..1228531 + 66 NuclAT_39 - -
- 1228466..1228531 + 66 NuclAT_39 - -
- 1228466..1228531 + 66 NuclAT_45 - -
- 1228466..1228531 + 66 NuclAT_45 - -
- 1228466..1228531 + 66 NuclAT_45 - -
- 1228466..1228531 + 66 NuclAT_45 - -
- 1228466..1228531 + 66 NuclAT_48 - -
- 1228466..1228531 + 66 NuclAT_48 - -
- 1228466..1228531 + 66 NuclAT_48 - -
- 1228466..1228531 + 66 NuclAT_48 - -
- 1228466..1228533 + 68 NuclAT_16 - -
- 1228466..1228533 + 68 NuclAT_16 - -
- 1228466..1228533 + 68 NuclAT_16 - -
- 1228466..1228533 + 68 NuclAT_16 - -
- 1228466..1228533 + 68 NuclAT_18 - -
- 1228466..1228533 + 68 NuclAT_18 - -
- 1228466..1228533 + 68 NuclAT_18 - -
- 1228466..1228533 + 68 NuclAT_18 - -
- 1228466..1228533 + 68 NuclAT_20 - -
- 1228466..1228533 + 68 NuclAT_20 - -
- 1228466..1228533 + 68 NuclAT_20 - -
- 1228466..1228533 + 68 NuclAT_20 - -
- 1228466..1228533 + 68 NuclAT_22 - -
- 1228466..1228533 + 68 NuclAT_22 - -
- 1228466..1228533 + 68 NuclAT_22 - -
- 1228466..1228533 + 68 NuclAT_22 - -
- 1228466..1228533 + 68 NuclAT_24 - -
- 1228466..1228533 + 68 NuclAT_24 - -
- 1228466..1228533 + 68 NuclAT_24 - -
- 1228466..1228533 + 68 NuclAT_24 - -
- 1228466..1228533 + 68 NuclAT_26 - -
- 1228466..1228533 + 68 NuclAT_26 - -
- 1228466..1228533 + 68 NuclAT_26 - -
- 1228466..1228533 + 68 NuclAT_26 - -
HO397_RS06005 1228846..1228953 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1229001..1229066 + 66 NuclAT_31 - -
- 1229001..1229066 + 66 NuclAT_31 - -
- 1229001..1229066 + 66 NuclAT_31 - -
- 1229001..1229066 + 66 NuclAT_31 - -
- 1229001..1229066 + 66 NuclAT_34 - -
- 1229001..1229066 + 66 NuclAT_34 - -
- 1229001..1229066 + 66 NuclAT_34 - -
- 1229001..1229066 + 66 NuclAT_34 - -
- 1229001..1229066 + 66 NuclAT_37 - -
- 1229001..1229066 + 66 NuclAT_37 - -
- 1229001..1229066 + 66 NuclAT_37 - -
- 1229001..1229066 + 66 NuclAT_37 - -
- 1229001..1229066 + 66 NuclAT_40 - -
- 1229001..1229066 + 66 NuclAT_40 - -
- 1229001..1229066 + 66 NuclAT_40 - -
- 1229001..1229066 + 66 NuclAT_40 - -
- 1229001..1229066 + 66 NuclAT_46 - -
- 1229001..1229066 + 66 NuclAT_46 - -
- 1229001..1229066 + 66 NuclAT_46 - -
- 1229001..1229066 + 66 NuclAT_46 - -
- 1229001..1229066 + 66 NuclAT_49 - -
- 1229001..1229066 + 66 NuclAT_49 - -
- 1229001..1229066 + 66 NuclAT_49 - -
- 1229001..1229066 + 66 NuclAT_49 - -
- 1229001..1229068 + 68 NuclAT_15 - -
- 1229001..1229068 + 68 NuclAT_15 - -
- 1229001..1229068 + 68 NuclAT_15 - -
- 1229001..1229068 + 68 NuclAT_15 - -
- 1229001..1229068 + 68 NuclAT_17 - -
- 1229001..1229068 + 68 NuclAT_17 - -
- 1229001..1229068 + 68 NuclAT_17 - -
- 1229001..1229068 + 68 NuclAT_17 - -
- 1229001..1229068 + 68 NuclAT_19 - -
- 1229001..1229068 + 68 NuclAT_19 - -
- 1229001..1229068 + 68 NuclAT_19 - -
- 1229001..1229068 + 68 NuclAT_19 - -
- 1229001..1229068 + 68 NuclAT_21 - -
- 1229001..1229068 + 68 NuclAT_21 - -
- 1229001..1229068 + 68 NuclAT_21 - -
- 1229001..1229068 + 68 NuclAT_21 - -
- 1229001..1229068 + 68 NuclAT_23 - -
- 1229001..1229068 + 68 NuclAT_23 - -
- 1229001..1229068 + 68 NuclAT_23 - -
- 1229001..1229068 + 68 NuclAT_23 - -
- 1229001..1229068 + 68 NuclAT_25 - -
- 1229001..1229068 + 68 NuclAT_25 - -
- 1229001..1229068 + 68 NuclAT_25 - -
- 1229001..1229068 + 68 NuclAT_25 - -
HO397_RS06010 1229358..1230458 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
HO397_RS06015 1230728..1230958 + 231 WP_001146444.1 putative cation transport regulator ChaB -
HO397_RS06020 1231116..1231811 + 696 WP_012775986.1 glutathione-specific gamma-glutamylcyclotransferase -
HO397_RS06025 1231855..1232208 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3961.74 Da        Isoelectric Point: 9.1413

>T157001 WP_000170951.1 NZ_CP053601:c1227883-1227776 [Escherichia coli BL21]
MTLAQFAMIFWDDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T157001 NZ_CP069074:c3095461-3095045 [Mycobacterium tuberculosis]
ATGACCACGCGCTATTTGCTCGACAAATCAGCGGCTTACCGCGCGCACTTGCCCGCGGTCCGACATCGCTTGGAACCGTT
GATGGAACGCGGTCTACTGGCCCGGTGCGGCATTACCGATCTCGAGTTCGGAGTCTCGGCGCGTTCCCGCGAGGACCATC
GAACACTGGGCACCTACCGGCGTGACGCGCTCGAATACGTCAACACCCCCGACACCGTGTGGGTTCGTGCATGGGAGATC
CAAGAAGCATTGACCGACAAGGGATTTCACCGCTCGGTCAAGATCCCGGACTTGATCATTGCGGCGGTCGCCGAGCATCA
CGGCATACCCGTCATGCACTACGACCAAGACTTCGAACGCATCGCCGCCATCACACGGCAACCCGTGGAATGGGTGGTGG
CCCCAGGGACAGCGTGA

Antitoxin


Download         Length: 64 bp

>AT157001 NZ_CP053601:1227933-1227996 [Escherichia coli BL21]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGATTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB E3PKK3

Antitoxin

Download structure file

References