Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-orzP/Ldr(toxin)
Location 2096765..2096987 Replicon chromosome
Accession NZ_CP053284
Organism Escherichia coli strain SCU-104

Toxin (Protein)


Gene name ldrD Uniprot ID D3H2K1
Locus tag HHJ22_RS10065 Protein ID WP_000170955.1
Coordinates 2096765..2096872 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name orzP
Locus tag -
Coordinates 2096920..2096987 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HHJ22_RS10035 2092621..2093454 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
HHJ22_RS10040 2093451..2093843 + 393 WP_000200374.1 invasion regulator SirB2 -
HHJ22_RS10045 2093847..2094656 + 810 WP_001257044.1 invasion regulator SirB1 -
HHJ22_RS10050 2094692..2095546 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
HHJ22_RS10055 2095695..2095802 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 2095850..2095916 + 67 NuclAT_32 - -
- 2095850..2095916 + 67 NuclAT_32 - -
- 2095850..2095916 + 67 NuclAT_32 - -
- 2095850..2095916 + 67 NuclAT_32 - -
- 2095850..2095916 + 67 NuclAT_34 - -
- 2095850..2095916 + 67 NuclAT_34 - -
- 2095850..2095916 + 67 NuclAT_34 - -
- 2095850..2095916 + 67 NuclAT_34 - -
- 2095850..2095916 + 67 NuclAT_36 - -
- 2095850..2095916 + 67 NuclAT_36 - -
- 2095850..2095916 + 67 NuclAT_36 - -
- 2095850..2095916 + 67 NuclAT_36 - -
- 2095850..2095916 + 67 NuclAT_38 - -
- 2095850..2095916 + 67 NuclAT_38 - -
- 2095850..2095916 + 67 NuclAT_38 - -
- 2095850..2095916 + 67 NuclAT_38 - -
- 2095850..2095916 + 67 NuclAT_40 - -
- 2095850..2095916 + 67 NuclAT_40 - -
- 2095850..2095916 + 67 NuclAT_40 - -
- 2095850..2095916 + 67 NuclAT_40 - -
- 2095850..2095916 + 67 NuclAT_42 - -
- 2095850..2095916 + 67 NuclAT_42 - -
- 2095850..2095916 + 67 NuclAT_42 - -
- 2095850..2095916 + 67 NuclAT_42 - -
- 2095852..2095917 + 66 NuclAT_15 - -
- 2095852..2095917 + 66 NuclAT_15 - -
- 2095852..2095917 + 66 NuclAT_15 - -
- 2095852..2095917 + 66 NuclAT_15 - -
- 2095852..2095917 + 66 NuclAT_18 - -
- 2095852..2095917 + 66 NuclAT_18 - -
- 2095852..2095917 + 66 NuclAT_18 - -
- 2095852..2095917 + 66 NuclAT_18 - -
- 2095852..2095917 + 66 NuclAT_21 - -
- 2095852..2095917 + 66 NuclAT_21 - -
- 2095852..2095917 + 66 NuclAT_21 - -
- 2095852..2095917 + 66 NuclAT_21 - -
- 2095852..2095917 + 66 NuclAT_24 - -
- 2095852..2095917 + 66 NuclAT_24 - -
- 2095852..2095917 + 66 NuclAT_24 - -
- 2095852..2095917 + 66 NuclAT_24 - -
- 2095852..2095917 + 66 NuclAT_27 - -
- 2095852..2095917 + 66 NuclAT_27 - -
- 2095852..2095917 + 66 NuclAT_27 - -
- 2095852..2095917 + 66 NuclAT_27 - -
- 2095852..2095917 + 66 NuclAT_30 - -
- 2095852..2095917 + 66 NuclAT_30 - -
- 2095852..2095917 + 66 NuclAT_30 - -
- 2095852..2095917 + 66 NuclAT_30 - -
HHJ22_RS10060 2096230..2096337 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 2096385..2096451 + 67 NuclAT_33 - -
- 2096385..2096451 + 67 NuclAT_33 - -
- 2096385..2096451 + 67 NuclAT_33 - -
- 2096385..2096451 + 67 NuclAT_33 - -
- 2096385..2096451 + 67 NuclAT_35 - -
- 2096385..2096451 + 67 NuclAT_35 - -
- 2096385..2096451 + 67 NuclAT_35 - -
- 2096385..2096451 + 67 NuclAT_35 - -
- 2096385..2096451 + 67 NuclAT_37 - -
- 2096385..2096451 + 67 NuclAT_37 - -
- 2096385..2096451 + 67 NuclAT_37 - -
- 2096385..2096451 + 67 NuclAT_37 - -
- 2096385..2096451 + 67 NuclAT_39 - -
- 2096385..2096451 + 67 NuclAT_39 - -
- 2096385..2096451 + 67 NuclAT_39 - -
- 2096385..2096451 + 67 NuclAT_39 - -
- 2096385..2096451 + 67 NuclAT_41 - -
- 2096385..2096451 + 67 NuclAT_41 - -
- 2096385..2096451 + 67 NuclAT_41 - -
- 2096385..2096451 + 67 NuclAT_41 - -
- 2096385..2096451 + 67 NuclAT_43 - -
- 2096385..2096451 + 67 NuclAT_43 - -
- 2096385..2096451 + 67 NuclAT_43 - -
- 2096385..2096451 + 67 NuclAT_43 - -
- 2096387..2096452 + 66 NuclAT_16 - -
- 2096387..2096452 + 66 NuclAT_16 - -
- 2096387..2096452 + 66 NuclAT_16 - -
- 2096387..2096452 + 66 NuclAT_16 - -
- 2096387..2096452 + 66 NuclAT_19 - -
- 2096387..2096452 + 66 NuclAT_19 - -
- 2096387..2096452 + 66 NuclAT_19 - -
- 2096387..2096452 + 66 NuclAT_19 - -
- 2096387..2096452 + 66 NuclAT_22 - -
- 2096387..2096452 + 66 NuclAT_22 - -
- 2096387..2096452 + 66 NuclAT_22 - -
- 2096387..2096452 + 66 NuclAT_22 - -
- 2096387..2096452 + 66 NuclAT_25 - -
- 2096387..2096452 + 66 NuclAT_25 - -
- 2096387..2096452 + 66 NuclAT_25 - -
- 2096387..2096452 + 66 NuclAT_25 - -
- 2096387..2096452 + 66 NuclAT_28 - -
- 2096387..2096452 + 66 NuclAT_28 - -
- 2096387..2096452 + 66 NuclAT_28 - -
- 2096387..2096452 + 66 NuclAT_28 - -
- 2096387..2096452 + 66 NuclAT_31 - -
- 2096387..2096452 + 66 NuclAT_31 - -
- 2096387..2096452 + 66 NuclAT_31 - -
- 2096387..2096452 + 66 NuclAT_31 - -
HHJ22_RS10065 2096765..2096872 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC Toxin
- 2096920..2096987 + 68 NuclAT_14 - Antitoxin
- 2096920..2096987 + 68 NuclAT_14 - Antitoxin
- 2096920..2096987 + 68 NuclAT_14 - Antitoxin
- 2096920..2096987 + 68 NuclAT_14 - Antitoxin
- 2096920..2096987 + 68 NuclAT_17 - Antitoxin
- 2096920..2096987 + 68 NuclAT_17 - Antitoxin
- 2096920..2096987 + 68 NuclAT_17 - Antitoxin
- 2096920..2096987 + 68 NuclAT_17 - Antitoxin
- 2096920..2096987 + 68 NuclAT_20 - Antitoxin
- 2096920..2096987 + 68 NuclAT_20 - Antitoxin
- 2096920..2096987 + 68 NuclAT_20 - Antitoxin
- 2096920..2096987 + 68 NuclAT_20 - Antitoxin
- 2096920..2096987 + 68 NuclAT_23 - Antitoxin
- 2096920..2096987 + 68 NuclAT_23 - Antitoxin
- 2096920..2096987 + 68 NuclAT_23 - Antitoxin
- 2096920..2096987 + 68 NuclAT_23 - Antitoxin
- 2096920..2096987 + 68 NuclAT_26 - Antitoxin
- 2096920..2096987 + 68 NuclAT_26 - Antitoxin
- 2096920..2096987 + 68 NuclAT_26 - Antitoxin
- 2096920..2096987 + 68 NuclAT_26 - Antitoxin
- 2096920..2096987 + 68 NuclAT_29 - Antitoxin
- 2096920..2096987 + 68 NuclAT_29 - Antitoxin
- 2096920..2096987 + 68 NuclAT_29 - Antitoxin
- 2096920..2096987 + 68 NuclAT_29 - Antitoxin
HHJ22_RS10070 2097276..2098376 - 1101 WP_000063607.1 sodium-potassium/proton antiporter ChaA -
HHJ22_RS10075 2098646..2098876 + 231 WP_001146444.1 putative cation transport regulator ChaB -
HHJ22_RS10080 2099034..2099729 + 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
HHJ22_RS10085 2099773..2100126 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
HHJ22_RS10090 2100311..2101705 + 1395 WP_000086217.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4013.82 Da        Isoelectric Point: 11.4779

>T156527 WP_000170955.1 NZ_CP053284:c2096872-2096765 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T156527 NZ_CP069066:2859149-2859526 [Mycobacterium tuberculosis]
GTGAAGCTGATCGACACCACCATCGCGGTCGACCACCTTCGCGGCGAACCCGCGGCAGCCGTGCTGCTCGCCGAACTGAT
AAACAACGGTGAGGAGATCGCGGCCAGCGAGCTGGTCCGATTCGAACTCCTCGCCGGTGTGCGGGAAAGCGAACTCGCGG
CGCTCGAGGCCTTCTTCTCGGCAGTGGTGTGGACCCTGGTGACCGAGGACATTGCCCGGATCGGCGGACGACTCGCCCGT
CGATACCGGTCCAGCCACCGCGGTATCGACGACGTGGACTACCTGATCGCTGCGACCGCCATTGTGGTCGACGCCGACCT
GCTCACCACCAATGTGCGCCACTTCCCGATGTTCCCGGATCTGCAGCCGCCGTACTGA

Antitoxin


Download         Length: 68 bp

>AT156527 NZ_CP053284:2096920-2096987 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829J2A9

Antitoxin

Download structure file

References