Detailed information of TA system TA156371

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-sokA/Ldr(toxin)
• Location: 3930812..3931036
• Replicon: chromosome
• Accession: NZ_CP053245
• Organism: Escherichia coli strain SCU-485

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: A0A366YNB7
• Locus tag: HHJ54_RS18720
• Protein ID: WP_001441942.1
• Coordinates: 3930812..3930919 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	sokA
Locus tag	-
Coordinates	3930975..3931036 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
HHJ54_RS18695	3926656..3927738	+	1083	WP_000804726.1	peptide chain release factor 1	-
HHJ54_RS18700	3927738..3928571	+	834	WP_000456476.1	peptide chain release factor N(5)-glutamine methyltransferase	-
HHJ54_RS18705	3928568..3928960	+	393	WP_000200375.1	invasion regulator SirB2	-
HHJ54_RS18710	3928964..3929773	+	810	WP_001257054.1	invasion regulator SirB1	-
HHJ54_RS18715	3929809..3930663	+	855	WP_000811065.1	3-deoxy-8-phosphooctulonate synthase	-
HHJ54_RS18720	3930812..3930919	-	108	WP_001441942.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	3930975..3931036	+	62	NuclAT_12	-	Antitoxin
-	3930975..3931036	+	62	NuclAT_12	-	Antitoxin
-	3930975..3931036	+	62	NuclAT_12	-	Antitoxin
-	3930975..3931036	+	62	NuclAT_12	-	Antitoxin
-	3930975..3931036	+	62	NuclAT_13	-	Antitoxin
-	3930975..3931036	+	62	NuclAT_13	-	Antitoxin
-	3930975..3931036	+	62	NuclAT_13	-	Antitoxin
-	3930975..3931036	+	62	NuclAT_13	-	Antitoxin
-	3930975..3931036	+	62	NuclAT_14	-	Antitoxin
-	3930975..3931036	+	62	NuclAT_14	-	Antitoxin
-	3930975..3931036	+	62	NuclAT_14	-	Antitoxin
-	3930975..3931036	+	62	NuclAT_14	-	Antitoxin
-	3930975..3931036	+	62	NuclAT_15	-	Antitoxin
-	3930975..3931036	+	62	NuclAT_15	-	Antitoxin
-	3930975..3931036	+	62	NuclAT_15	-	Antitoxin
-	3930975..3931036	+	62	NuclAT_15	-	Antitoxin
-	3930975..3931036	+	62	NuclAT_16	-	Antitoxin
-	3930975..3931036	+	62	NuclAT_16	-	Antitoxin
-	3930975..3931036	+	62	NuclAT_16	-	Antitoxin
-	3930975..3931036	+	62	NuclAT_16	-	Antitoxin
-	3930975..3931036	+	62	NuclAT_17	-	Antitoxin
-	3930975..3931036	+	62	NuclAT_17	-	Antitoxin
-	3930975..3931036	+	62	NuclAT_17	-	Antitoxin
-	3930975..3931036	+	62	NuclAT_17	-	Antitoxin
-	3930975..3931037	+	63	NuclAT_10	-	-
-	3930975..3931037	+	63	NuclAT_10	-	-
-	3930975..3931037	+	63	NuclAT_10	-	-
-	3930975..3931037	+	63	NuclAT_10	-	-
-	3930975..3931037	+	63	NuclAT_5	-	-
-	3930975..3931037	+	63	NuclAT_5	-	-
-	3930975..3931037	+	63	NuclAT_5	-	-
-	3930975..3931037	+	63	NuclAT_5	-	-
-	3930975..3931037	+	63	NuclAT_6	-	-
-	3930975..3931037	+	63	NuclAT_6	-	-
-	3930975..3931037	+	63	NuclAT_6	-	-
-	3930975..3931037	+	63	NuclAT_6	-	-
-	3930975..3931037	+	63	NuclAT_7	-	-
-	3930975..3931037	+	63	NuclAT_7	-	-
-	3930975..3931037	+	63	NuclAT_7	-	-
-	3930975..3931037	+	63	NuclAT_7	-	-
-	3930975..3931037	+	63	NuclAT_8	-	-
-	3930975..3931037	+	63	NuclAT_8	-	-
-	3930975..3931037	+	63	NuclAT_8	-	-
-	3930975..3931037	+	63	NuclAT_8	-	-
-	3930975..3931037	+	63	NuclAT_9	-	-
-	3930975..3931037	+	63	NuclAT_9	-	-
-	3930975..3931037	+	63	NuclAT_9	-	-
-	3930975..3931037	+	63	NuclAT_9	-	-
HHJ54_RS18725	3931329..3932429	-	1101	WP_000063608.1	sodium-potassium/proton antiporter ChaA	-
HHJ54_RS18730	3932699..3932929	+	231	WP_001146435.1	putative cation transport regulator ChaB	-
HHJ54_RS18735	3933087..3933782	+	696	WP_024176023.1	glutathione-specific gamma-glutamylcyclotransferase	-
HHJ54_RS18740	3933826..3934179	-	354	WP_001169659.1	DsrE/F sulfur relay family protein YchN	-
HHJ54_RS18745	3934364..3935758	+	1395	WP_000085918.1	inverse autotransporter invasin YchO	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 3951.74 Da
• Isoelectric Point: 11.4779

>T156371 WP_001441942.1 NZ_CP053245:c3930919-3930812 [Escherichia coli]
MTLAQFAVIFWHDLAAPILAGIITAAIVGWWRNRK

Nucleotide

• Length: 108 bp

>T156371 NZ_CP069063:3768152-3768409 [Mycobacterium tuberculosis]
GTGAGAAGCGTCAACTTCGATCCCGATGCCTGGGAGGACTTCTTGTTCTGGCTGGCCGCTGATCGCAAAACGGCCCGTCG
GATCACCCGGTTGATCGGAGAAATTCAGCGTGATCCGTTCAGCGGGATCGGCAAACCCGAGCCGCTCCAAGGTGAGTTGT
CGGGATACTGGTCGCGCCGGATCGACGACGAACACCGGCTGGTGTATCGAGCGGGCGACGACGAAGTCACGATGCTGAAG
GCCCGATACCACTACTGA

Antitoxin

Nucleotide

• Length: 62 bp

>AT156371 NZ_CP053245:3930975-3931036 [Escherichia coli]
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTGACCTCTCAACGTGCGGGGGTTTTCT

Structures

Toxin

• AlphaFold DB: A0A366YNB7

Antitoxin