Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | holin-SprF3/- |
Location | 370918..371366 | Replicon | chromosome |
Accession | NZ_CP053185 | ||
Organism | Staphylococcus aureus strain Guangzhou-SAU749 |
Toxin (Protein)
Gene name | holin | Uniprot ID | A0A853P973 |
Locus tag | HLG72_RS01770 | Protein ID | WP_000387656.1 |
Coordinates | 371064..371366 (+) | Length | 101 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 370918..370984 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HLG72_RS01740 | 366013..369695 | + | 3683 | Protein_345 | hypothetical protein | - |
HLG72_RS01745 | 369682..369834 | + | 153 | WP_001181555.1 | hypothetical protein | - |
HLG72_RS01750 | 369881..370155 | + | 275 | Protein_347 | hypothetical protein | - |
HLG72_RS01755 | 370229..370525 | + | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
HLG72_RS01760 | 370718..370865 | + | 148 | Protein_349 | putative holin-like toxin | - |
HLG72_RS01765 | 370909..371013 | - | 105 | Protein_350 | hypothetical protein | - |
- | 370918..370984 | - | 67 | NuclAT_0 | - | Antitoxin |
- | 370918..370984 | - | 67 | NuclAT_0 | - | Antitoxin |
- | 370918..370984 | - | 67 | NuclAT_0 | - | Antitoxin |
- | 370918..370984 | - | 67 | NuclAT_0 | - | Antitoxin |
HLG72_RS01770 | 371064..371366 | + | 303 | WP_000387656.1 | phage holin | Toxin |
HLG72_RS01775 | 371378..372834 | + | 1457 | Protein_352 | N-acetylmuramoyl-L-alanine amidase | - |
HLG72_RS01780 | 373080..373232 | + | 153 | WP_001788502.1 | hypothetical protein | - |
HLG72_RS01785 | 373303..373414 | + | 112 | Protein_354 | hypothetical protein | - |
HLG72_RS01790 | 373416..373602 | + | 187 | Protein_355 | hypothetical protein | - |
HLG72_RS01795 | 373951..374876 | + | 926 | Protein_356 | hypothetical protein | - |
HLG72_RS01800 | 375099..375282 | + | 184 | Protein_357 | hypothetical protein | - |
HLG72_RS01805 | 375279..375965 | + | 687 | Protein_358 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 333424..373607 | 40183 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11177.94 Da Isoelectric Point: 9.6587
>T156206 WP_000387656.1 NZ_CP053185:371064-371366 [Staphylococcus aureus]
MEAKVMARYVVLILALVNQFLANKGISPIPVDEESISSIILTVIALYTTYKDNPTSQEGRWANQKLKKYKAESKYRKATG
QAPIKEVMTPTNMNDTNDLG
MEAKVMARYVVLILALVNQFLANKGISPIPVDEESISSIILTVIALYTTYKDNPTSQEGRWANQKLKKYKAESKYRKATG
QAPIKEVMTPTNMNDTNDLG
Download Length: 303 bp
>T156206 NZ_CP068972:1898843-1898945 [Klebsiella pneumoniae]
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
Antitoxin
Download Length: 67 bp
>AT156206 NZ_CP053185:c370984-370918 [Staphylococcus aureus]
ATAAATAGAAAAAGGGCAACATGCGGAAACATGTTACCCTAGTGAGCCCGTTAAAAAGACGGTGGCT
ATAAATAGAAAAAGGGCAACATGCGGAAACATGTTACCCTAGTGAGCCCGTTAAAAAGACGGTGGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|