Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 98632..99217 | Replicon | chromosome |
Accession | NZ_CP053084 | ||
Organism | Limnobacter sp. SAORIC-580 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | HKT17_RS00440 | Protein ID | WP_171101316.1 |
Coordinates | 98903..99217 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | HKT17_RS00435 | Protein ID | WP_171096978.1 |
Coordinates | 98632..98913 (-) | Length | 94 a.a. |
Genomic Context
Location: 94691..95020 (330 bp)
Type: Others
Protein ID: WP_171096970.1
Type: Others
Protein ID: WP_171096970.1
Location: 95771..96163 (393 bp)
Type: Others
Protein ID: WP_171096974.1
Type: Others
Protein ID: WP_171096974.1
Location: 96300..97211 (912 bp)
Type: Others
Protein ID: WP_171101314.1
Type: Others
Protein ID: WP_171101314.1
Location: 98436..98564 (129 bp)
Type: Others
Protein ID: Protein_85
Type: Others
Protein ID: Protein_85
Location: 93945..94589 (645 bp)
Type: Others
Protein ID: WP_171096967.1
Type: Others
Protein ID: WP_171096967.1
Location: 95023..95637 (615 bp)
Type: Others
Protein ID: WP_171096972.1
Type: Others
Protein ID: WP_171096972.1
Location: 97968..98321 (354 bp)
Type: Others
Protein ID: WP_171096976.1
Type: Others
Protein ID: WP_171096976.1
Location: 98632..98913 (282 bp)
Type: Antitoxin
Protein ID: WP_171096978.1
Type: Antitoxin
Protein ID: WP_171096978.1
Location: 98903..99217 (315 bp)
Type: Toxin
Protein ID: WP_171101316.1
Type: Toxin
Protein ID: WP_171101316.1
Location: 99470..100171 (702 bp)
Type: Others
Protein ID: WP_171096980.1
Type: Others
Protein ID: WP_171096980.1
Location: 100177..100644 (468 bp)
Type: Others
Protein ID: WP_171096982.1
Type: Others
Protein ID: WP_171096982.1
Location: 100645..101520 (876 bp)
Type: Others
Protein ID: WP_171096984.1
Type: Others
Protein ID: WP_171096984.1
Location: 101941..103560 (1620 bp)
Type: Others
Protein ID: WP_171096986.1
Type: Others
Protein ID: WP_171096986.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HKT17_RS00400 | 93945..94589 | - | 645 | WP_171096967.1 | MBL fold metallo-hydrolase | - |
HKT17_RS00405 | 94691..95020 | + | 330 | WP_171096970.1 | DUF2834 domain-containing protein | - |
HKT17_RS00410 | 95023..95637 | - | 615 | WP_171096972.1 | alternative oxidase | - |
HKT17_RS00415 | 95771..96163 | + | 393 | WP_171096974.1 | DUF1311 domain-containing protein | - |
HKT17_RS00420 | 96300..97211 | + | 912 | WP_171101314.1 | NERD domain-containing protein | - |
HKT17_RS00425 | 97968..98321 | - | 354 | WP_171096976.1 | hypothetical protein | - |
HKT17_RS00430 | 98436..98564 | + | 129 | Protein_85 | tyrosine-type recombinase/integrase | - |
HKT17_RS00435 | 98632..98913 | - | 282 | WP_171096978.1 | helix-turn-helix domain-containing protein | Antitoxin |
HKT17_RS00440 | 98903..99217 | - | 315 | WP_171101316.1 | transcriptional regulator | Toxin |
HKT17_RS00445 | 99470..100171 | - | 702 | WP_171096980.1 | hypothetical protein | - |
HKT17_RS00450 | 100177..100644 | - | 468 | WP_171096982.1 | hypothetical protein | - |
HKT17_RS00455 | 100645..101520 | - | 876 | WP_171096984.1 | ParA family protein | - |
HKT17_RS00460 | 101941..103560 | - | 1620 | WP_171096986.1 | DUF2326 domain-containing protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11460.08 Da Isoelectric Point: 8.9373
>T156006 WP_171101316.1 NZ_CP053084:c99217-98903 [Limnobacter sp. SAORIC-580]
VRTVAETPIFQKYASDVWSDAERIEFINWIANNPEAGDVIPGSGGCRKVRWSSAGQGKRGGARVIYFNATEAAIWLLIVY
KKAKFDNLPTAFLAELKKGVEDGL
VRTVAETPIFQKYASDVWSDAERIEFINWIANNPEAGDVIPGSGGCRKVRWSSAGQGKRGGARVIYFNATEAAIWLLIVY
KKAKFDNLPTAFLAELKKGVEDGL
Download Length: 315 bp
>T156006 NZ_CP068823:c2192168-2192061 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 94 a.a. Molecular weight: 10191.78 Da Isoelectric Point: 10.7721
>AT156006 WP_171096978.1 NZ_CP053084:c98913-98632 [Limnobacter sp. SAORIC-580]
MDSEMKKFQDDLLKSVKQMRQGKAARINQVELSPAAEARAKMGLSQQAFASLLGVSVRTLQDWEQGRRSPTGAAKTLLKV
AVSHPEVLREIGA
MDSEMKKFQDDLLKSVKQMRQGKAARINQVELSPAAEARAKMGLSQQAFASLLGVSVRTLQDWEQGRRSPTGAAKTLLKV
AVSHPEVLREIGA
Download Length: 282 bp
>AT156006 NZ_CP068823:2192218-2192281 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT