Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 4348199..4348457 | Replicon | chromosome |
| Accession | NZ_CP053045 | ||
| Organism | Escherichia fergusonii strain HNCF11W | ||
Toxin (Protein)
| Gene name | hokA | Uniprot ID | F4T5C6 |
| Locus tag | HG538_RS21000 | Protein ID | WP_001135731.1 |
| Coordinates | 4348199..4348351 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokA | ||
| Locus tag | - | ||
| Coordinates | 4348402..4348457 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HG538_RS20975 | 4344064..4344774 | - | 711 | WP_000190514.1 | DUF3053 domain-containing protein | - |
| HG538_RS20980 | 4345212..4346582 | + | 1371 | WP_000184983.1 | MFS transporter | - |
| HG538_RS20985 | 4346832..4347122 | + | 291 | WP_000455800.1 | HTH-type transcriptional regulator | - |
| HG538_RS20990 | 4347404..4347616 | + | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
| HG538_RS20995 | 4347670..4348041 | - | 372 | WP_001037803.1 | membrane protein insertion efficiency factor YidD | - |
| HG538_RS21000 | 4348199..4348351 | - | 153 | WP_001135731.1 | type I toxin-antitoxin system toxin HokA | Toxin |
| - | 4348402..4348457 | + | 56 | - | - | Antitoxin |
| HG538_RS21005 | 4348674..4350743 | - | 2070 | WP_001291792.1 | glycine--tRNA ligase subunit beta | - |
| HG538_RS21010 | 4350753..4351664 | - | 912 | WP_001168544.1 | glycine--tRNA ligase subunit alpha | - |
| HG538_RS21015 | 4351760..4352059 | - | 300 | WP_024256552.1 | YsaB family lipoprotein | - |
| HG538_RS21020 | 4352231..4353226 | + | 996 | WP_002432855.1 | acyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 6025.30 Da Isoelectric Point: 7.7169
>T155888 WP_001135731.1 NZ_CP053045:c4348351-4348199 [Escherichia fergusonii]
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQENYELAAFLACKLKE
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQENYELAAFLACKLKE
Download Length: 153 bp
>T155888 NZ_CP068819:260168-260275 [Escherichia coli]
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CATGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CATGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 56 bp
>AT155888 NZ_CP053045:4348402-4348457 [Escherichia fergusonii]
GTTGAAGCATAGAGGCAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
GTTGAAGCATAGAGGCAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|