Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-sokC/Ldr(toxin) |
| Location | 4318852..4319071 | Replicon | chromosome |
| Accession | NZ_CP053045 | ||
| Organism | Escherichia fergusonii strain HNCF11W | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1NWX0 |
| Locus tag | HG538_RS20860 | Protein ID | WP_001295224.1 |
| Coordinates | 4318852..4318959 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | sokC | ||
| Locus tag | - | ||
| Coordinates | 4319008..4319071 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HG538_RS20830 | 4313893..4315452 | + | 1560 | WP_001070267.1 | cellulose biosynthesis protein BcsE | - |
| HG538_RS20835 | 4315449..4315640 | + | 192 | WP_000981122.1 | cellulose biosynthesis protein BcsF | - |
| HG538_RS20840 | 4315637..4317316 | + | 1680 | WP_000192007.1 | cellulose biosynthesis protein BcsG | - |
| HG538_RS20845 | 4317403..4317510 | - | 108 | WP_114091462.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| HG538_RS20850 | 4317886..4317993 | - | 108 | WP_000170738.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 4318042..4318105 | + | 64 | NuclAT_16 | - | - |
| - | 4318042..4318105 | + | 64 | NuclAT_16 | - | - |
| - | 4318042..4318105 | + | 64 | NuclAT_16 | - | - |
| - | 4318042..4318105 | + | 64 | NuclAT_16 | - | - |
| - | 4318042..4318105 | + | 64 | NuclAT_19 | - | - |
| - | 4318042..4318105 | + | 64 | NuclAT_19 | - | - |
| - | 4318042..4318105 | + | 64 | NuclAT_19 | - | - |
| - | 4318042..4318105 | + | 64 | NuclAT_19 | - | - |
| - | 4318042..4318105 | + | 64 | NuclAT_22 | - | - |
| - | 4318042..4318105 | + | 64 | NuclAT_22 | - | - |
| - | 4318042..4318105 | + | 64 | NuclAT_22 | - | - |
| - | 4318042..4318105 | + | 64 | NuclAT_22 | - | - |
| - | 4318042..4318105 | + | 64 | NuclAT_25 | - | - |
| - | 4318042..4318105 | + | 64 | NuclAT_25 | - | - |
| - | 4318042..4318105 | + | 64 | NuclAT_25 | - | - |
| - | 4318042..4318105 | + | 64 | NuclAT_25 | - | - |
| - | 4318042..4318107 | + | 66 | NuclAT_12 | - | - |
| - | 4318042..4318107 | + | 66 | NuclAT_12 | - | - |
| - | 4318042..4318107 | + | 66 | NuclAT_12 | - | - |
| - | 4318042..4318107 | + | 66 | NuclAT_12 | - | - |
| - | 4318042..4318107 | + | 66 | NuclAT_9 | - | - |
| - | 4318042..4318107 | + | 66 | NuclAT_9 | - | - |
| - | 4318042..4318107 | + | 66 | NuclAT_9 | - | - |
| - | 4318042..4318107 | + | 66 | NuclAT_9 | - | - |
| HG538_RS20855 | 4318369..4318476 | - | 108 | WP_000170738.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 4318525..4318588 | + | 64 | NuclAT_17 | - | - |
| - | 4318525..4318588 | + | 64 | NuclAT_17 | - | - |
| - | 4318525..4318588 | + | 64 | NuclAT_17 | - | - |
| - | 4318525..4318588 | + | 64 | NuclAT_17 | - | - |
| - | 4318525..4318588 | + | 64 | NuclAT_20 | - | - |
| - | 4318525..4318588 | + | 64 | NuclAT_20 | - | - |
| - | 4318525..4318588 | + | 64 | NuclAT_20 | - | - |
| - | 4318525..4318588 | + | 64 | NuclAT_20 | - | - |
| - | 4318525..4318588 | + | 64 | NuclAT_23 | - | - |
| - | 4318525..4318588 | + | 64 | NuclAT_23 | - | - |
| - | 4318525..4318588 | + | 64 | NuclAT_23 | - | - |
| - | 4318525..4318588 | + | 64 | NuclAT_23 | - | - |
| - | 4318525..4318588 | + | 64 | NuclAT_26 | - | - |
| - | 4318525..4318588 | + | 64 | NuclAT_26 | - | - |
| - | 4318525..4318588 | + | 64 | NuclAT_26 | - | - |
| - | 4318525..4318588 | + | 64 | NuclAT_26 | - | - |
| - | 4318525..4318590 | + | 66 | NuclAT_10 | - | - |
| - | 4318525..4318590 | + | 66 | NuclAT_10 | - | - |
| - | 4318525..4318590 | + | 66 | NuclAT_10 | - | - |
| - | 4318525..4318590 | + | 66 | NuclAT_10 | - | - |
| - | 4318525..4318590 | + | 66 | NuclAT_13 | - | - |
| - | 4318525..4318590 | + | 66 | NuclAT_13 | - | - |
| - | 4318525..4318590 | + | 66 | NuclAT_13 | - | - |
| - | 4318525..4318590 | + | 66 | NuclAT_13 | - | - |
| HG538_RS20860 | 4318852..4318959 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 4319008..4319071 | + | 64 | NuclAT_15 | - | Antitoxin |
| - | 4319008..4319071 | + | 64 | NuclAT_15 | - | Antitoxin |
| - | 4319008..4319071 | + | 64 | NuclAT_15 | - | Antitoxin |
| - | 4319008..4319071 | + | 64 | NuclAT_15 | - | Antitoxin |
| - | 4319008..4319071 | + | 64 | NuclAT_18 | - | Antitoxin |
| - | 4319008..4319071 | + | 64 | NuclAT_18 | - | Antitoxin |
| - | 4319008..4319071 | + | 64 | NuclAT_18 | - | Antitoxin |
| - | 4319008..4319071 | + | 64 | NuclAT_18 | - | Antitoxin |
| - | 4319008..4319071 | + | 64 | NuclAT_21 | - | Antitoxin |
| - | 4319008..4319071 | + | 64 | NuclAT_21 | - | Antitoxin |
| - | 4319008..4319071 | + | 64 | NuclAT_21 | - | Antitoxin |
| - | 4319008..4319071 | + | 64 | NuclAT_21 | - | Antitoxin |
| - | 4319008..4319071 | + | 64 | NuclAT_24 | - | Antitoxin |
| - | 4319008..4319071 | + | 64 | NuclAT_24 | - | Antitoxin |
| - | 4319008..4319071 | + | 64 | NuclAT_24 | - | Antitoxin |
| - | 4319008..4319071 | + | 64 | NuclAT_24 | - | Antitoxin |
| - | 4319008..4319073 | + | 66 | NuclAT_11 | - | - |
| - | 4319008..4319073 | + | 66 | NuclAT_11 | - | - |
| - | 4319008..4319073 | + | 66 | NuclAT_11 | - | - |
| - | 4319008..4319073 | + | 66 | NuclAT_11 | - | - |
| - | 4319008..4319073 | + | 66 | NuclAT_8 | - | - |
| - | 4319008..4319073 | + | 66 | NuclAT_8 | - | - |
| - | 4319008..4319073 | + | 66 | NuclAT_8 | - | - |
| - | 4319008..4319073 | + | 66 | NuclAT_8 | - | - |
| HG538_RS20865 | 4319395..4320591 | + | 1197 | WP_001016303.1 | methionine gamma-lyase | - |
| HG538_RS20870 | 4320840..4322138 | + | 1299 | WP_001152711.1 | amino acid permease | - |
| HG538_RS20875 | 4322154..4323365 | - | 1212 | WP_000256500.1 | sigma 54-interacting transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T155886 WP_001295224.1 NZ_CP053045:c4318959-4318852 [Escherichia fergusonii]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T155886 NZ_CP068819:259201-259308 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGCATGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGCATGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA
Antitoxin
Download Length: 64 bp
>AT155886 NZ_CP053045:4319008-4319071 [Escherichia fergusonii]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|