Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-symR/Ldr(toxin)
Location 4317886..4318105 Replicon chromosome
Accession NZ_CP053045
Organism Escherichia fergusonii strain HNCF11W

Toxin (Protein)


Gene name ldrD Uniprot ID A0A829L523
Locus tag HG538_RS20850 Protein ID WP_000170738.1
Coordinates 4317886..4317993 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name symR
Locus tag -
Coordinates 4318042..4318105 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HG538_RS20825 4313418..4313606 - 189 WP_001063310.1 YhjR family protein -
HG538_RS20830 4313893..4315452 + 1560 WP_001070267.1 cellulose biosynthesis protein BcsE -
HG538_RS20835 4315449..4315640 + 192 WP_000981122.1 cellulose biosynthesis protein BcsF -
HG538_RS20840 4315637..4317316 + 1680 WP_000192007.1 cellulose biosynthesis protein BcsG -
HG538_RS20845 4317403..4317510 - 108 WP_114091462.1 type I toxin-antitoxin system toxin Ldr family protein -
HG538_RS20850 4317886..4317993 - 108 WP_000170738.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 4318042..4318105 + 64 NuclAT_16 - Antitoxin
- 4318042..4318105 + 64 NuclAT_16 - Antitoxin
- 4318042..4318105 + 64 NuclAT_16 - Antitoxin
- 4318042..4318105 + 64 NuclAT_16 - Antitoxin
- 4318042..4318105 + 64 NuclAT_19 - Antitoxin
- 4318042..4318105 + 64 NuclAT_19 - Antitoxin
- 4318042..4318105 + 64 NuclAT_19 - Antitoxin
- 4318042..4318105 + 64 NuclAT_19 - Antitoxin
- 4318042..4318105 + 64 NuclAT_22 - Antitoxin
- 4318042..4318105 + 64 NuclAT_22 - Antitoxin
- 4318042..4318105 + 64 NuclAT_22 - Antitoxin
- 4318042..4318105 + 64 NuclAT_22 - Antitoxin
- 4318042..4318105 + 64 NuclAT_25 - Antitoxin
- 4318042..4318105 + 64 NuclAT_25 - Antitoxin
- 4318042..4318105 + 64 NuclAT_25 - Antitoxin
- 4318042..4318105 + 64 NuclAT_25 - Antitoxin
- 4318042..4318107 + 66 NuclAT_12 - -
- 4318042..4318107 + 66 NuclAT_12 - -
- 4318042..4318107 + 66 NuclAT_12 - -
- 4318042..4318107 + 66 NuclAT_12 - -
- 4318042..4318107 + 66 NuclAT_9 - -
- 4318042..4318107 + 66 NuclAT_9 - -
- 4318042..4318107 + 66 NuclAT_9 - -
- 4318042..4318107 + 66 NuclAT_9 - -
HG538_RS20855 4318369..4318476 - 108 WP_000170738.1 type I toxin-antitoxin system toxin Ldr family protein -
- 4318525..4318588 + 64 NuclAT_17 - -
- 4318525..4318588 + 64 NuclAT_17 - -
- 4318525..4318588 + 64 NuclAT_17 - -
- 4318525..4318588 + 64 NuclAT_17 - -
- 4318525..4318588 + 64 NuclAT_20 - -
- 4318525..4318588 + 64 NuclAT_20 - -
- 4318525..4318588 + 64 NuclAT_20 - -
- 4318525..4318588 + 64 NuclAT_20 - -
- 4318525..4318588 + 64 NuclAT_23 - -
- 4318525..4318588 + 64 NuclAT_23 - -
- 4318525..4318588 + 64 NuclAT_23 - -
- 4318525..4318588 + 64 NuclAT_23 - -
- 4318525..4318588 + 64 NuclAT_26 - -
- 4318525..4318588 + 64 NuclAT_26 - -
- 4318525..4318588 + 64 NuclAT_26 - -
- 4318525..4318588 + 64 NuclAT_26 - -
- 4318525..4318590 + 66 NuclAT_10 - -
- 4318525..4318590 + 66 NuclAT_10 - -
- 4318525..4318590 + 66 NuclAT_10 - -
- 4318525..4318590 + 66 NuclAT_10 - -
- 4318525..4318590 + 66 NuclAT_13 - -
- 4318525..4318590 + 66 NuclAT_13 - -
- 4318525..4318590 + 66 NuclAT_13 - -
- 4318525..4318590 + 66 NuclAT_13 - -
HG538_RS20860 4318852..4318959 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
- 4319008..4319071 + 64 NuclAT_15 - -
- 4319008..4319071 + 64 NuclAT_15 - -
- 4319008..4319071 + 64 NuclAT_15 - -
- 4319008..4319071 + 64 NuclAT_15 - -
- 4319008..4319071 + 64 NuclAT_18 - -
- 4319008..4319071 + 64 NuclAT_18 - -
- 4319008..4319071 + 64 NuclAT_18 - -
- 4319008..4319071 + 64 NuclAT_18 - -
- 4319008..4319071 + 64 NuclAT_21 - -
- 4319008..4319071 + 64 NuclAT_21 - -
- 4319008..4319071 + 64 NuclAT_21 - -
- 4319008..4319071 + 64 NuclAT_21 - -
- 4319008..4319071 + 64 NuclAT_24 - -
- 4319008..4319071 + 64 NuclAT_24 - -
- 4319008..4319071 + 64 NuclAT_24 - -
- 4319008..4319071 + 64 NuclAT_24 - -
- 4319008..4319073 + 66 NuclAT_11 - -
- 4319008..4319073 + 66 NuclAT_11 - -
- 4319008..4319073 + 66 NuclAT_11 - -
- 4319008..4319073 + 66 NuclAT_11 - -
- 4319008..4319073 + 66 NuclAT_8 - -
- 4319008..4319073 + 66 NuclAT_8 - -
- 4319008..4319073 + 66 NuclAT_8 - -
- 4319008..4319073 + 66 NuclAT_8 - -
HG538_RS20865 4319395..4320591 + 1197 WP_001016303.1 methionine gamma-lyase -
HG538_RS20870 4320840..4322138 + 1299 WP_001152711.1 amino acid permease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3864.67 Da        Isoelectric Point: 9.0157

>T155882 WP_000170738.1 NZ_CP053045:c4317993-4317886 [Escherichia fergusonii]
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK

Download         Length: 108 bp

>T155882 NZ_CP068818:c4764034-4763861 [Escherichia coli]
ATGGCACTATTCTCTAAAATATTAATTTTTTATGTGATTGGTGTGAACATATCCTTTGTCATTATCTGGTTTATCTCACA
TGAGAAAACACATATTCGTTTACTTAGTGCATTCCTGGTCGGAATAACCTGGCCAATGAGTCTGCCTGTGGCATTACTTT
TTTCTCTCTTTTAG

Antitoxin


Download         Length: 64 bp

>AT155882 NZ_CP053045:4318042-4318105 [Escherichia fergusonii]
GTCTAGATGCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829L523

Antitoxin

Download structure file

References