Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 996175..996421 | Replicon | chromosome |
Accession | NZ_CP053045 | ||
Organism | Escherichia fergusonii strain HNCF11W |
Toxin (Protein)
Gene name | hokX | Uniprot ID | S1PD89 |
Locus tag | HG538_RS04780 | Protein ID | WP_000956458.1 |
Coordinates | 996269..996421 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokX | ||
Locus tag | - | ||
Coordinates | 996175..996227 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HG538_RS04765 | 991683..993482 | + | 1800 | WP_105223450.1 | NADPH-dependent assimilatory sulfite reductase flavoprotein subunit | - |
HG538_RS04770 | 993482..995194 | + | 1713 | WP_001003080.1 | assimilatory sulfite reductase (NADPH) hemoprotein subunit | - |
HG538_RS04775 | 995268..996002 | + | 735 | WP_000039850.1 | phosphoadenosine phosphosulfate reductase | - |
- | 996175..996227 | - | 53 | - | - | Antitoxin |
HG538_RS04780 | 996269..996421 | + | 153 | WP_000956458.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
HG538_RS04785 | 996657..999314 | + | 2658 | WP_002431960.1 | CRISPR-associated helicase/endonuclease Cas3 | - |
HG538_RS04790 | 999412..1000839 | + | 1428 | WP_171881978.1 | type I-E CRISPR-associated protein Cse1/CasA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5558.77 Da Isoelectric Point: 7.6757
>T155868 WP_000956458.1 NZ_CP053045:996269-996421 [Escherichia fergusonii]
MLTKYALVAIIVLCCTVLGFTLMVGDSLCELSIRERGMEFKAVLAYESKK
MLTKYALVAIIVLCCTVLGFTLMVGDSLCELSIRERGMEFKAVLAYESKK
Download Length: 153 bp
>T155868 NZ_CP068818:2222496-2222599 [Escherichia coli]
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT
Antitoxin
Download Length: 53 bp
>AT155868 NZ_CP053045:c996227-996175 [Escherichia fergusonii]
TTAGGTTCGAACGCTGGCCTCAGGTTGATAGAAATATCGCCTGGGGCTTTTGT
TTAGGTTCGAACGCTGGCCTCAGGTTGATAGAAATATCGCCTGGGGCTTTTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|