Detailed information of TA system TA155177

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/Ldr(toxin)
• Location: 4930579..4930800
• Replicon: chromosome
• Accession: NZ_CP051735
• Organism: Escherichia coli strain SCU-108

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: S1PGT3
• Locus tag: HHJ26_RS23675
• Protein ID: WP_000170954.1
• Coordinates: 4930579..4930686 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	-
Coordinates	4930739..4930800 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
HHJ26_RS23650	4926424..4927506	+	1083	WP_000804726.1	peptide chain release factor 1	-
HHJ26_RS23655	4927506..4928339	+	834	WP_000456474.1	peptide chain release factor N(5)-glutamine methyltransferase	-
HHJ26_RS23660	4928336..4928728	+	393	WP_000200375.1	invasion regulator SirB2	-
HHJ26_RS23665	4928732..4929541	+	810	WP_001257054.1	invasion regulator SirB1	-
HHJ26_RS23670	4929577..4930431	+	855	WP_000811065.1	3-deoxy-8-phosphooctulonate synthase	-
HHJ26_RS23675	4930579..4930686	-	108	WP_000170954.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	4930739..4930800	+	62	NuclAT_12	-	Antitoxin
-	4930739..4930800	+	62	NuclAT_12	-	Antitoxin
-	4930739..4930800	+	62	NuclAT_12	-	Antitoxin
-	4930739..4930800	+	62	NuclAT_12	-	Antitoxin
-	4930739..4930800	+	62	NuclAT_13	-	Antitoxin
-	4930739..4930800	+	62	NuclAT_13	-	Antitoxin
-	4930739..4930800	+	62	NuclAT_13	-	Antitoxin
-	4930739..4930800	+	62	NuclAT_13	-	Antitoxin
-	4930739..4930800	+	62	NuclAT_14	-	Antitoxin
-	4930739..4930800	+	62	NuclAT_14	-	Antitoxin
-	4930739..4930800	+	62	NuclAT_14	-	Antitoxin
-	4930739..4930800	+	62	NuclAT_14	-	Antitoxin
-	4930739..4930800	+	62	NuclAT_15	-	Antitoxin
-	4930739..4930800	+	62	NuclAT_15	-	Antitoxin
-	4930739..4930800	+	62	NuclAT_15	-	Antitoxin
-	4930739..4930800	+	62	NuclAT_15	-	Antitoxin
-	4930739..4930800	+	62	NuclAT_16	-	Antitoxin
-	4930739..4930800	+	62	NuclAT_16	-	Antitoxin
-	4930739..4930800	+	62	NuclAT_16	-	Antitoxin
-	4930739..4930800	+	62	NuclAT_16	-	Antitoxin
-	4930739..4930800	+	62	NuclAT_17	-	Antitoxin
-	4930739..4930800	+	62	NuclAT_17	-	Antitoxin
-	4930739..4930800	+	62	NuclAT_17	-	Antitoxin
-	4930739..4930800	+	62	NuclAT_17	-	Antitoxin
-	4930739..4930801	+	63	NuclAT_10	-	-
-	4930739..4930801	+	63	NuclAT_10	-	-
-	4930739..4930801	+	63	NuclAT_10	-	-
-	4930739..4930801	+	63	NuclAT_10	-	-
-	4930739..4930801	+	63	NuclAT_11	-	-
-	4930739..4930801	+	63	NuclAT_11	-	-
-	4930739..4930801	+	63	NuclAT_11	-	-
-	4930739..4930801	+	63	NuclAT_11	-	-
-	4930739..4930801	+	63	NuclAT_6	-	-
-	4930739..4930801	+	63	NuclAT_6	-	-
-	4930739..4930801	+	63	NuclAT_6	-	-
-	4930739..4930801	+	63	NuclAT_6	-	-
-	4930739..4930801	+	63	NuclAT_7	-	-
-	4930739..4930801	+	63	NuclAT_7	-	-
-	4930739..4930801	+	63	NuclAT_7	-	-
-	4930739..4930801	+	63	NuclAT_7	-	-
-	4930739..4930801	+	63	NuclAT_8	-	-
-	4930739..4930801	+	63	NuclAT_8	-	-
-	4930739..4930801	+	63	NuclAT_8	-	-
-	4930739..4930801	+	63	NuclAT_8	-	-
-	4930739..4930801	+	63	NuclAT_9	-	-
-	4930739..4930801	+	63	NuclAT_9	-	-
-	4930739..4930801	+	63	NuclAT_9	-	-
-	4930739..4930801	+	63	NuclAT_9	-	-
-	4930739..4930802	+	64	NuclAT_18	-	-
-	4930739..4930802	+	64	NuclAT_18	-	-
-	4930739..4930802	+	64	NuclAT_18	-	-
-	4930739..4930802	+	64	NuclAT_18	-	-
-	4930739..4930802	+	64	NuclAT_19	-	-
-	4930739..4930802	+	64	NuclAT_19	-	-
-	4930739..4930802	+	64	NuclAT_19	-	-
-	4930739..4930802	+	64	NuclAT_19	-	-
-	4930739..4930802	+	64	NuclAT_20	-	-
-	4930739..4930802	+	64	NuclAT_20	-	-
-	4930739..4930802	+	64	NuclAT_20	-	-
-	4930739..4930802	+	64	NuclAT_20	-	-
-	4930739..4930802	+	64	NuclAT_21	-	-
-	4930739..4930802	+	64	NuclAT_21	-	-
-	4930739..4930802	+	64	NuclAT_21	-	-
-	4930739..4930802	+	64	NuclAT_21	-	-
-	4930739..4930802	+	64	NuclAT_22	-	-
-	4930739..4930802	+	64	NuclAT_22	-	-
-	4930739..4930802	+	64	NuclAT_22	-	-
-	4930739..4930802	+	64	NuclAT_22	-	-
-	4930739..4930802	+	64	NuclAT_23	-	-
-	4930739..4930802	+	64	NuclAT_23	-	-
-	4930739..4930802	+	64	NuclAT_23	-	-
-	4930739..4930802	+	64	NuclAT_23	-	-
HHJ26_RS23680	4931092..4932192	-	1101	WP_001313768.1	sodium-potassium/proton antiporter ChaA	-
HHJ26_RS23685	4932462..4932692	+	231	WP_001146444.1	putative cation transport regulator ChaB	-
HHJ26_RS23690	4932850..4933545	+	696	WP_000632706.1	glutathione-specific gamma-glutamylcyclotransferase	-
HHJ26_RS23695	4933589..4933942	-	354	WP_001169659.1	DsrE/F sulfur relay family protein YchN	-
HHJ26_RS23700	4934127..4935521	+	1395	WP_000086194.1	inverse autotransporter invasin YchO	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 3983.80 Da
• Isoelectric Point: 11.4779

>T155177 WP_000170954.1 NZ_CP051735:c4930686-4930579 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Nucleotide

• Length: 108 bp

>T155177 NZ_CP068689:915297-915704 [Klebsiella pneumoniae subsp. pneumoniae]
GTGGTCCTGTGGCAATCTGATCTCCGTATCTCCTGGCGCGCGCAGTGGTTTTCCCTGCTGCTTCACGGCGTGGTGGCGGC
CCTGGTGCTGTTGGTTCCCTGGCCGCTGAGCTATACCCCGATCTGGCTGCTGCTGTCGCTGGTGGTCTTCGACTGCGTGC
GCAGCCAGCGGCGGATCCATGCCCGTCGCGGGGAGATAAAACTGCTCACCGATTCCCGTCTTCGCTGGCAAAACGCCGAA
TGGGAAATCCTCGGGACGCCGTGGGTTATCAATAGCGGTATGCTGCTGCGTTTGCGCCATGTCGATACCCGGCGCGGACA
GCATCTTTGGCTGGCGGCGGACAGCATGGACGCCGGAGAGTGGCGCGATCTGCGCCGGCTGGTGCTGCAAAAACCGGCGC
AGGAGTAA

Antitoxin

Nucleotide

• Length: 62 bp

>AT155177 NZ_CP051735:4930739-4930800 [Escherichia coli]
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Structures

Toxin

• AlphaFold DB: A0A7U9LPE9

Antitoxin