Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-sokA/Ldr(toxin)
Location 2703814..2704036 Replicon chromosome
Accession NZ_CP051698
Organism Escherichia coli strain SCU-152

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag HHJ40_RS12930 Protein ID WP_000170965.1
Coordinates 2703929..2704036 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name sokA
Locus tag -
Coordinates 2703814..2703881 (-)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HHJ40_RS12905 2699095..2700489 - 1395 WP_000086213.1 inverse autotransporter invasin YchO -
HHJ40_RS12910 2700674..2701027 + 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
HHJ40_RS12915 2701071..2701766 - 696 WP_001355927.1 glutathione-specific gamma-glutamylcyclotransferase -
HHJ40_RS12920 2701924..2702154 - 231 WP_001146442.1 putative cation transport regulator ChaB -
HHJ40_RS12925 2702424..2703524 + 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
- 2703814..2703881 - 68 NuclAT_13 - Antitoxin
- 2703814..2703881 - 68 NuclAT_13 - Antitoxin
- 2703814..2703881 - 68 NuclAT_13 - Antitoxin
- 2703814..2703881 - 68 NuclAT_13 - Antitoxin
- 2703814..2703881 - 68 NuclAT_14 - Antitoxin
- 2703814..2703881 - 68 NuclAT_14 - Antitoxin
- 2703814..2703881 - 68 NuclAT_14 - Antitoxin
- 2703814..2703881 - 68 NuclAT_14 - Antitoxin
- 2703814..2703881 - 68 NuclAT_15 - Antitoxin
- 2703814..2703881 - 68 NuclAT_15 - Antitoxin
- 2703814..2703881 - 68 NuclAT_15 - Antitoxin
- 2703814..2703881 - 68 NuclAT_15 - Antitoxin
- 2703814..2703881 - 68 NuclAT_16 - Antitoxin
- 2703814..2703881 - 68 NuclAT_16 - Antitoxin
- 2703814..2703881 - 68 NuclAT_16 - Antitoxin
- 2703814..2703881 - 68 NuclAT_16 - Antitoxin
- 2703814..2703881 - 68 NuclAT_17 - Antitoxin
- 2703814..2703881 - 68 NuclAT_17 - Antitoxin
- 2703814..2703881 - 68 NuclAT_17 - Antitoxin
- 2703814..2703881 - 68 NuclAT_17 - Antitoxin
- 2703814..2703881 - 68 NuclAT_18 - Antitoxin
- 2703814..2703881 - 68 NuclAT_18 - Antitoxin
- 2703814..2703881 - 68 NuclAT_18 - Antitoxin
- 2703814..2703881 - 68 NuclAT_18 - Antitoxin
HHJ40_RS12930 2703929..2704036 + 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2704350..2704416 - 67 NuclAT_19 - -
- 2704350..2704416 - 67 NuclAT_19 - -
- 2704350..2704416 - 67 NuclAT_19 - -
- 2704350..2704416 - 67 NuclAT_19 - -
- 2704350..2704416 - 67 NuclAT_20 - -
- 2704350..2704416 - 67 NuclAT_20 - -
- 2704350..2704416 - 67 NuclAT_20 - -
- 2704350..2704416 - 67 NuclAT_20 - -
- 2704350..2704416 - 67 NuclAT_21 - -
- 2704350..2704416 - 67 NuclAT_21 - -
- 2704350..2704416 - 67 NuclAT_21 - -
- 2704350..2704416 - 67 NuclAT_21 - -
- 2704350..2704416 - 67 NuclAT_22 - -
- 2704350..2704416 - 67 NuclAT_22 - -
- 2704350..2704416 - 67 NuclAT_22 - -
- 2704350..2704416 - 67 NuclAT_22 - -
- 2704350..2704416 - 67 NuclAT_23 - -
- 2704350..2704416 - 67 NuclAT_23 - -
- 2704350..2704416 - 67 NuclAT_23 - -
- 2704350..2704416 - 67 NuclAT_23 - -
- 2704350..2704416 - 67 NuclAT_24 - -
- 2704350..2704416 - 67 NuclAT_24 - -
- 2704350..2704416 - 67 NuclAT_24 - -
- 2704350..2704416 - 67 NuclAT_24 - -
- 2704351..2704414 - 64 NuclAT_25 - -
- 2704351..2704414 - 64 NuclAT_25 - -
- 2704351..2704414 - 64 NuclAT_25 - -
- 2704351..2704414 - 64 NuclAT_25 - -
- 2704351..2704414 - 64 NuclAT_26 - -
- 2704351..2704414 - 64 NuclAT_26 - -
- 2704351..2704414 - 64 NuclAT_26 - -
- 2704351..2704414 - 64 NuclAT_26 - -
- 2704351..2704414 - 64 NuclAT_27 - -
- 2704351..2704414 - 64 NuclAT_27 - -
- 2704351..2704414 - 64 NuclAT_27 - -
- 2704351..2704414 - 64 NuclAT_27 - -
HHJ40_RS12935 2704464..2704571 + 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
HHJ40_RS12940 2704720..2705574 - 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
HHJ40_RS12945 2705610..2706419 - 810 WP_001257044.1 invasion regulator SirB1 -
HHJ40_RS12950 2706423..2706815 - 393 WP_000200378.1 invasion regulator SirB2 -
HHJ40_RS12955 2706812..2707645 - 834 WP_000456571.1 peptide chain release factor N(5)-glutamine methyltransferase -
HHJ40_RS12960 2707645..2708727 - 1083 WP_000804726.1 peptide chain release factor 1 -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T154855 WP_000170965.1 NZ_CP051698:2703929-2704036 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T154855 NZ_CP068285:c1390227-1389973 [Ralstonia syzygii subsp. celebesensis]
ATGAAAGCCAAACACCAGAAGACGCTGGAGCTGATCTTTTCCCGCCCTACGCCAGCGGGCGTTAAGTGGGCCGATGCCGT
CACGCTCATGCGAGAACTGGGCGCGGAATTGGAGGAGCGCGAGGGTTCTCGCGTGGCCGTCTTCCTGTTTGGTCAAGTTA
AAGTGATGCATCGACCACACCCATCGCCCGATATGGACAAGGGCGCTGTGGCCTCGATGCGTAAGTGGTTCGAGGAAAAC
GGAGTCAAGCCATGA

Antitoxin


Download         Length: 68 bp

>AT154855 NZ_CP051698:c2703881-2703814 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029


Antitoxin

Download structure file

References