Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 4884618..4884840 | Replicon | chromosome |
| Accession | NZ_CP051688 | ||
| Organism | Escherichia coli strain SCU-387 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1NWX0 |
| Locus tag | HHJ48_RS23730 | Protein ID | WP_001295224.1 |
| Coordinates | 4884618..4884725 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 4884774..4884840 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HHJ48_RS23705 | 4879871..4880623 | - | 753 | WP_000279525.1 | cellulose biosynthesis protein BcsQ | - |
| HHJ48_RS23710 | 4880635..4880823 | - | 189 | WP_001063314.1 | YhjR family protein | - |
| HHJ48_RS23715 | 4881096..4882667 | + | 1572 | Protein_4637 | cellulose biosynthesis protein BcsE | - |
| HHJ48_RS23720 | 4882664..4882855 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| HHJ48_RS23725 | 4882852..4884531 | + | 1680 | WP_000191567.1 | cellulose biosynthesis protein BcsG | - |
| HHJ48_RS23730 | 4884618..4884725 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 4884774..4884840 | + | 67 | - | - | Antitoxin |
| HHJ48_RS23735 | 4885201..4886472 | + | 1272 | WP_001298005.1 | amino acid permease | - |
| HHJ48_RS23740 | 4886502..4887506 | - | 1005 | WP_000103577.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| HHJ48_RS23745 | 4887503..4888486 | - | 984 | WP_001540025.1 | dipeptide ABC transporter ATP-binding protein | - |
| HHJ48_RS23750 | 4888497..4889399 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T154781 WP_001295224.1 NZ_CP051688:c4884725-4884618 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T154781 NZ_CP068279:c3073986-3073883 [Escherichia coli]
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT
Antitoxin
Download Length: 67 bp
>AT154781 NZ_CP051688:4884774-4884840 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGATATTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGGTTCAAGATTAGCCCCCGTGATATTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|