Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 82072..82311 | Replicon | plasmid pEco1162invT2b |
Accession | NZ_CP051665 | ||
Organism | Escherichia coli strain 1162invT2 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | A0A762TWR7 |
Locus tag | HH200_RS24995 | Protein ID | WP_023144756.1 |
Coordinates | 82072..82206 (-) | Length | 45 a.a. |
Antitoxin (RNA)
Gene name | srnC | ||
Locus tag | - | ||
Coordinates | 82251..82311 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HH200_RS24960 (78083) | 78083..78484 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
HH200_RS24965 (78417) | 78417..78674 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
HH200_RS24970 (78767) | 78767..79420 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
HH200_RS24975 (80360) | 80360..81217 | - | 858 | WP_001617855.1 | incFII family plasmid replication initiator RepA | - |
HH200_RS24980 (81210) | 81210..81284 | - | 75 | WP_031943482.1 | RepA leader peptide Tap | - |
HH200_RS24985 (81284) | 81284..81415 | - | 132 | Protein_99 | protein CopA/IncA | - |
HH200_RS24990 (81521) | 81521..81775 | - | 255 | WP_000083850.1 | replication regulatory protein RepA | - |
HH200_RS24995 (82072) | 82072..82206 | - | 135 | WP_023144756.1 | Hok/Gef family protein | Toxin |
- (82251) | 82251..82311 | + | 61 | NuclAT_2 | - | Antitoxin |
- (82251) | 82251..82311 | + | 61 | NuclAT_2 | - | Antitoxin |
- (82251) | 82251..82311 | + | 61 | NuclAT_2 | - | Antitoxin |
- (82251) | 82251..82311 | + | 61 | NuclAT_2 | - | Antitoxin |
HH200_RS25000 (82278) | 82278..82564 | - | 287 | Protein_102 | DUF2726 domain-containing protein | - |
HH200_RS25005 (82642) | 82642..84255 | - | 1614 | WP_000080195.1 | IS66-like element ISEc23 family transposase | - |
HH200_RS25010 (84286) | 84286..84636 | - | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
HH200_RS25015 (84633) | 84633..85058 | - | 426 | WP_000422741.1 | transposase | - |
HH200_RS25020 (85617) | 85617..85829 | - | 213 | WP_013023861.1 | hypothetical protein | - |
HH200_RS25025 (85960) | 85960..86520 | - | 561 | WP_000139341.1 | fertility inhibition protein FinO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / aac(3)-IId / blaTEM-1B | senB | 1..157396 | 157396 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T154733 WP_023144756.1 NZ_CP051665:c82206-82072 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
>T154733 NZ_CP068239:c147615-147334 [Pseudomonas aeruginosa]
ATGAGCCTGAAGTGGACCCGCAAGGCGGCCGCCGACCTGGACGCCATCTACGACCATTACGTCGTGCTGATCGGCCCGGA
AAAAGCCCTGAAAGCCGTCCAGGACATCGTCGAGCAGGTGAAACCGCTGCAGCAGGTAGCCAACCAGGGGGCAGGGCGGC
CCAGCGAGGTGCCAGGCGTACGCACCCTGACCCTGGAGCGCTGGCCGTTCAGCGCCCCTTTTCGGGTAAAAGGCAAGGAA
ATCCAGATTTTGCGCATCGACAGGGTCGAAATTACCCCCTAA
ATGAGCCTGAAGTGGACCCGCAAGGCGGCCGCCGACCTGGACGCCATCTACGACCATTACGTCGTGCTGATCGGCCCGGA
AAAAGCCCTGAAAGCCGTCCAGGACATCGTCGAGCAGGTGAAACCGCTGCAGCAGGTAGCCAACCAGGGGGCAGGGCGGC
CCAGCGAGGTGCCAGGCGTACGCACCCTGACCCTGGAGCGCTGGCCGTTCAGCGCCCCTTTTCGGGTAAAAGGCAAGGAA
ATCCAGATTTTGCGCATCGACAGGGTCGAAATTACCCCCTAA
Antitoxin
Download Length: 61 bp
>AT154733 NZ_CP051665:82251-82311 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|