Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-sokC/Ldr(toxin)
Location 421660..421881 Replicon chromosome
Accession NZ_CP051663
Organism Escherichia coli strain 1162invT2

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1U9U3P9
Locus tag HH200_RS02330 Protein ID WP_001531632.1
Coordinates 421660..421767 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name sokC
Locus tag -
Coordinates 421815..421881 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HH200_RS02305 (417504) 417504..418586 + 1083 WP_000804726.1 peptide chain release factor 1 -
HH200_RS02310 (418586) 418586..419419 + 834 WP_000456450.1 peptide chain release factor N(5)-glutamine methyltransferase -
HH200_RS02315 (419416) 419416..419808 + 393 WP_000200375.1 invasion regulator SirB2 -
HH200_RS02320 (419812) 419812..420621 + 810 WP_001257044.1 invasion regulator SirB1 -
HH200_RS02325 (420657) 420657..421511 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
HH200_RS02330 (421660) 421660..421767 - 108 WP_001531632.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (421817) 421817..421880 + 64 NuclAT_12 - -
- (421817) 421817..421880 + 64 NuclAT_12 - -
- (421817) 421817..421880 + 64 NuclAT_12 - -
- (421817) 421817..421880 + 64 NuclAT_12 - -
- (421817) 421817..421880 + 64 NuclAT_13 - -
- (421817) 421817..421880 + 64 NuclAT_13 - -
- (421817) 421817..421880 + 64 NuclAT_13 - -
- (421817) 421817..421880 + 64 NuclAT_13 - -
- (421817) 421817..421880 + 64 NuclAT_14 - -
- (421817) 421817..421880 + 64 NuclAT_14 - -
- (421817) 421817..421880 + 64 NuclAT_14 - -
- (421817) 421817..421880 + 64 NuclAT_14 - -
- (421817) 421817..421880 + 64 NuclAT_15 - -
- (421817) 421817..421880 + 64 NuclAT_15 - -
- (421817) 421817..421880 + 64 NuclAT_15 - -
- (421817) 421817..421880 + 64 NuclAT_15 - -
- (421817) 421817..421880 + 64 NuclAT_16 - -
- (421817) 421817..421880 + 64 NuclAT_16 - -
- (421817) 421817..421880 + 64 NuclAT_16 - -
- (421817) 421817..421880 + 64 NuclAT_16 - -
- (421817) 421817..421880 + 64 NuclAT_17 - -
- (421817) 421817..421880 + 64 NuclAT_17 - -
- (421817) 421817..421880 + 64 NuclAT_17 - -
- (421817) 421817..421880 + 64 NuclAT_17 - -
- (421815) 421815..421881 + 67 NuclAT_10 - Antitoxin
- (421815) 421815..421881 + 67 NuclAT_10 - Antitoxin
- (421815) 421815..421881 + 67 NuclAT_10 - Antitoxin
- (421815) 421815..421881 + 67 NuclAT_10 - Antitoxin
- (421815) 421815..421881 + 67 NuclAT_5 - Antitoxin
- (421815) 421815..421881 + 67 NuclAT_5 - Antitoxin
- (421815) 421815..421881 + 67 NuclAT_5 - Antitoxin
- (421815) 421815..421881 + 67 NuclAT_5 - Antitoxin
- (421815) 421815..421881 + 67 NuclAT_6 - Antitoxin
- (421815) 421815..421881 + 67 NuclAT_6 - Antitoxin
- (421815) 421815..421881 + 67 NuclAT_6 - Antitoxin
- (421815) 421815..421881 + 67 NuclAT_6 - Antitoxin
- (421815) 421815..421881 + 67 NuclAT_7 - Antitoxin
- (421815) 421815..421881 + 67 NuclAT_7 - Antitoxin
- (421815) 421815..421881 + 67 NuclAT_7 - Antitoxin
- (421815) 421815..421881 + 67 NuclAT_7 - Antitoxin
- (421815) 421815..421881 + 67 NuclAT_8 - Antitoxin
- (421815) 421815..421881 + 67 NuclAT_8 - Antitoxin
- (421815) 421815..421881 + 67 NuclAT_8 - Antitoxin
- (421815) 421815..421881 + 67 NuclAT_8 - Antitoxin
- (421815) 421815..421881 + 67 NuclAT_9 - Antitoxin
- (421815) 421815..421881 + 67 NuclAT_9 - Antitoxin
- (421815) 421815..421881 + 67 NuclAT_9 - Antitoxin
- (421815) 421815..421881 + 67 NuclAT_9 - Antitoxin
- (421817) 421817..421882 + 66 NuclAT_18 - -
- (421817) 421817..421882 + 66 NuclAT_18 - -
- (421817) 421817..421882 + 66 NuclAT_18 - -
- (421817) 421817..421882 + 66 NuclAT_18 - -
- (421817) 421817..421882 + 66 NuclAT_19 - -
- (421817) 421817..421882 + 66 NuclAT_19 - -
- (421817) 421817..421882 + 66 NuclAT_19 - -
- (421817) 421817..421882 + 66 NuclAT_19 - -
- (421817) 421817..421882 + 66 NuclAT_20 - -
- (421817) 421817..421882 + 66 NuclAT_20 - -
- (421817) 421817..421882 + 66 NuclAT_20 - -
- (421817) 421817..421882 + 66 NuclAT_20 - -
- (421817) 421817..421882 + 66 NuclAT_21 - -
- (421817) 421817..421882 + 66 NuclAT_21 - -
- (421817) 421817..421882 + 66 NuclAT_21 - -
- (421817) 421817..421882 + 66 NuclAT_21 - -
- (421817) 421817..421882 + 66 NuclAT_22 - -
- (421817) 421817..421882 + 66 NuclAT_22 - -
- (421817) 421817..421882 + 66 NuclAT_22 - -
- (421817) 421817..421882 + 66 NuclAT_22 - -
- (421817) 421817..421882 + 66 NuclAT_23 - -
- (421817) 421817..421882 + 66 NuclAT_23 - -
- (421817) 421817..421882 + 66 NuclAT_23 - -
- (421817) 421817..421882 + 66 NuclAT_23 - -
HH200_RS02335 (422172) 422172..423272 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
HH200_RS02340 (423542) 423542..423781 + 240 WP_000120702.1 putative cation transport regulator ChaB -
HH200_RS02345 (423930) 423930..424625 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
HH200_RS02350 (424669) 424669..425022 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
HH200_RS02355 (425207) 425207..426601 + 1395 WP_000086187.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4040.89 Da        Isoelectric Point: 12.5163

>T154702 WP_001531632.1 NZ_CP051663:c421767-421660 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

>T154702 NZ_CP068229:1369918-1370340 [Shewanella algae]
GTGGCCGGGCAGCGCCATAGGTTTCAACTCAGTTCTTCCTTCAGCCAGTATCTGAGTCTGACGGTGCTGGCTGCTATTTG
CCTGAGCAGCTTTCTTGCCTGGCCGGCGCTGGATTATCCTTTCTATTTATTGTTCAAATACCTATGTTTACTGCTAATGC
TGGCAGGCTTTGGCCTTGCGCTGTGGCGTTTGCGCTGCTGGCAACTCTGTTTCTGGCTTAATGAATTGGGTGAAGGACAG
TTCGAACCCGGTTCGAGTTTCGAACTTAGTGGCAGACCTTGGGTCAGCCCCTTTGTGGTGACTTTTACCTATCAGGGGGA
GGATAACTACGGGCGTTGCTGGCTGTTTGCCGATATGTTTGACGACACAGACTATCGTCACCTGTGTCGTCTATTGTTGC
AGCGCTCAAAGTCCGCTAACTGA

Antitoxin


Download         Length: 67 bp

>AT154702 NZ_CP051663:421815-421881 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1U9U3P9

Antitoxin

Download structure file

References