Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-timR/Ldr(toxin)
Location 4950714..4950935 Replicon chromosome
Accession NZ_CP051661
Organism Escherichia coli strain 1162T7

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1U9U3P9
Locus tag HH201_RS24330 Protein ID WP_001531632.1
Coordinates 4950714..4950821 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name timR
Locus tag -
Coordinates 4950869..4950935 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HH201_RS24305 (4946558) 4946558..4947640 + 1083 WP_000804726.1 peptide chain release factor 1 -
HH201_RS24310 (4947640) 4947640..4948473 + 834 WP_000456450.1 peptide chain release factor N(5)-glutamine methyltransferase -
HH201_RS24315 (4948470) 4948470..4948862 + 393 WP_000200375.1 invasion regulator SirB2 -
HH201_RS24320 (4948866) 4948866..4949675 + 810 WP_001257044.1 invasion regulator SirB1 -
HH201_RS24325 (4949711) 4949711..4950565 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
HH201_RS24330 (4950714) 4950714..4950821 - 108 WP_001531632.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (4950871) 4950871..4950934 + 64 NuclAT_13 - -
- (4950871) 4950871..4950934 + 64 NuclAT_13 - -
- (4950871) 4950871..4950934 + 64 NuclAT_13 - -
- (4950871) 4950871..4950934 + 64 NuclAT_13 - -
- (4950871) 4950871..4950934 + 64 NuclAT_14 - -
- (4950871) 4950871..4950934 + 64 NuclAT_14 - -
- (4950871) 4950871..4950934 + 64 NuclAT_14 - -
- (4950871) 4950871..4950934 + 64 NuclAT_14 - -
- (4950871) 4950871..4950934 + 64 NuclAT_15 - -
- (4950871) 4950871..4950934 + 64 NuclAT_15 - -
- (4950871) 4950871..4950934 + 64 NuclAT_15 - -
- (4950871) 4950871..4950934 + 64 NuclAT_15 - -
- (4950871) 4950871..4950934 + 64 NuclAT_16 - -
- (4950871) 4950871..4950934 + 64 NuclAT_16 - -
- (4950871) 4950871..4950934 + 64 NuclAT_16 - -
- (4950871) 4950871..4950934 + 64 NuclAT_16 - -
- (4950871) 4950871..4950934 + 64 NuclAT_17 - -
- (4950871) 4950871..4950934 + 64 NuclAT_17 - -
- (4950871) 4950871..4950934 + 64 NuclAT_17 - -
- (4950871) 4950871..4950934 + 64 NuclAT_17 - -
- (4950871) 4950871..4950934 + 64 NuclAT_18 - -
- (4950871) 4950871..4950934 + 64 NuclAT_18 - -
- (4950871) 4950871..4950934 + 64 NuclAT_18 - -
- (4950871) 4950871..4950934 + 64 NuclAT_18 - -
- (4950869) 4950869..4950935 + 67 NuclAT_10 - Antitoxin
- (4950869) 4950869..4950935 + 67 NuclAT_10 - Antitoxin
- (4950869) 4950869..4950935 + 67 NuclAT_10 - Antitoxin
- (4950869) 4950869..4950935 + 67 NuclAT_10 - Antitoxin
- (4950869) 4950869..4950935 + 67 NuclAT_11 - Antitoxin
- (4950869) 4950869..4950935 + 67 NuclAT_11 - Antitoxin
- (4950869) 4950869..4950935 + 67 NuclAT_11 - Antitoxin
- (4950869) 4950869..4950935 + 67 NuclAT_11 - Antitoxin
- (4950869) 4950869..4950935 + 67 NuclAT_6 - Antitoxin
- (4950869) 4950869..4950935 + 67 NuclAT_6 - Antitoxin
- (4950869) 4950869..4950935 + 67 NuclAT_6 - Antitoxin
- (4950869) 4950869..4950935 + 67 NuclAT_6 - Antitoxin
- (4950869) 4950869..4950935 + 67 NuclAT_7 - Antitoxin
- (4950869) 4950869..4950935 + 67 NuclAT_7 - Antitoxin
- (4950869) 4950869..4950935 + 67 NuclAT_7 - Antitoxin
- (4950869) 4950869..4950935 + 67 NuclAT_7 - Antitoxin
- (4950869) 4950869..4950935 + 67 NuclAT_8 - Antitoxin
- (4950869) 4950869..4950935 + 67 NuclAT_8 - Antitoxin
- (4950869) 4950869..4950935 + 67 NuclAT_8 - Antitoxin
- (4950869) 4950869..4950935 + 67 NuclAT_8 - Antitoxin
- (4950869) 4950869..4950935 + 67 NuclAT_9 - Antitoxin
- (4950869) 4950869..4950935 + 67 NuclAT_9 - Antitoxin
- (4950869) 4950869..4950935 + 67 NuclAT_9 - Antitoxin
- (4950869) 4950869..4950935 + 67 NuclAT_9 - Antitoxin
- (4950871) 4950871..4950936 + 66 NuclAT_19 - -
- (4950871) 4950871..4950936 + 66 NuclAT_19 - -
- (4950871) 4950871..4950936 + 66 NuclAT_19 - -
- (4950871) 4950871..4950936 + 66 NuclAT_19 - -
- (4950871) 4950871..4950936 + 66 NuclAT_20 - -
- (4950871) 4950871..4950936 + 66 NuclAT_20 - -
- (4950871) 4950871..4950936 + 66 NuclAT_20 - -
- (4950871) 4950871..4950936 + 66 NuclAT_20 - -
- (4950871) 4950871..4950936 + 66 NuclAT_21 - -
- (4950871) 4950871..4950936 + 66 NuclAT_21 - -
- (4950871) 4950871..4950936 + 66 NuclAT_21 - -
- (4950871) 4950871..4950936 + 66 NuclAT_21 - -
- (4950871) 4950871..4950936 + 66 NuclAT_22 - -
- (4950871) 4950871..4950936 + 66 NuclAT_22 - -
- (4950871) 4950871..4950936 + 66 NuclAT_22 - -
- (4950871) 4950871..4950936 + 66 NuclAT_22 - -
- (4950871) 4950871..4950936 + 66 NuclAT_23 - -
- (4950871) 4950871..4950936 + 66 NuclAT_23 - -
- (4950871) 4950871..4950936 + 66 NuclAT_23 - -
- (4950871) 4950871..4950936 + 66 NuclAT_23 - -
- (4950871) 4950871..4950936 + 66 NuclAT_24 - -
- (4950871) 4950871..4950936 + 66 NuclAT_24 - -
- (4950871) 4950871..4950936 + 66 NuclAT_24 - -
- (4950871) 4950871..4950936 + 66 NuclAT_24 - -
HH201_RS24335 (4951226) 4951226..4952326 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
HH201_RS24340 (4952596) 4952596..4952835 + 240 WP_000120702.1 putative cation transport regulator ChaB -
HH201_RS24345 (4952984) 4952984..4953679 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
HH201_RS24350 (4953723) 4953723..4954076 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
HH201_RS24355 (4954261) 4954261..4955655 + 1395 WP_000086187.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4040.89 Da        Isoelectric Point: 12.5163

>T154696 WP_001531632.1 NZ_CP051661:c4950821-4950714 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

>T154696 NZ_CP068227:1087296-1088042 [Shewanella algae]
ATGGATTTTAGCGCGTTAGAGCCGCAGGACTTTTTCCCTCGCCCCTACCTTGGCCGCGGTTATCGCCTGGTCGAGTCCCA
GGAAGAAGCCGCCACCCTGAGCCTGGTGGATGATTTTGACGAACAGATGCTGCTTGAGTCTCTGCTCGATGAGGTTAAAC
CGCCTTACCGAAGTGGAACAGAGCACTTGCATTATCTGCTCAAGACCCCGTTTCGTTATCCGCCGCTGCGCCATGGCTCG
CGCTTTGGCAGTATCACAATGGAAAGCTTCTTTTATGCCAGTGAATCCTGGCAGACCTGTTTGGCCGAAGTTGCTTACTA
TCGTTTTGTCTTTATGGCAGACATGCTGGAGCCTTATCTGGAGCCGCTGCGCTCTGAGCATATGCTGTACTCTGTGGATA
TCAATGCCCGCGATTGTGCCGACCTGACGCTATTGCAGGGGCAGGAAGTGCAGCAGCAACTGACTCACAAGTCGAACTAT
ACCTATACCCAGGCTATGGGGGCCTGGCTGCTGCAACAGCAGGCGCAGATGATCCGCTACACTTCGGCCAGAGCCGAAGA
GGGCGTTAATCTGGCGCTGCACGATCCTTTGGTATTGCAATCAACCGAGCCGCAGGAGTGTGAATACTGGATCTGCCAAA
GCTCGGCCGCCAAGGTGGCTTTCAGTCGTCGTAATAGCCGTAGCATGCCATTGACCTGGTTTTTAAAAGACTTTTTGCAG
GACGGGCAGTTGCCGCGTCCTGCCTGA

Antitoxin


Download         Length: 67 bp

>AT154696 NZ_CP051661:4950869-4950935 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1U9U3P9

Antitoxin

Download structure file

References