Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yefM-yoeB (relBE)/Txe-RelB |
| Location | 2031572..2032091 | Replicon | chromosome |
| Accession | NZ_CP051643 | ||
| Organism | Staphylococcus caprae strain SY333 | ||
Toxin (Protein)
| Gene name | yoeB | Uniprot ID | - |
| Locus tag | HHJ99_RS09895 | Protein ID | WP_044466383.1 |
| Coordinates | 2031572..2031841 (-) | Length | 90 a.a. |
Antitoxin (Protein)
| Gene name | yefM | Uniprot ID | - |
| Locus tag | HHJ99_RS09900 | Protein ID | WP_037541721.1 |
| Coordinates | 2031834..2032091 (-) | Length | 86 a.a. |
Genomic Context
Location: 2028296..2029054 (759 bp)
Type: Others
Protein ID: WP_044466379.1
Type: Others
Protein ID: WP_044466379.1
Location: 2029872..2031011 (1140 bp)
Type: Others
Protein ID: WP_044466381.1
Type: Others
Protein ID: WP_044466381.1
Location: 2032281..2033138 (858 bp)
Type: Others
Protein ID: WP_044466384.1
Type: Others
Protein ID: WP_044466384.1
Location: 2035065..2035511 (447 bp)
Type: Others
Protein ID: WP_002444594.1
Type: Others
Protein ID: WP_002444594.1
Location: 2029323..2029634 (312 bp)
Type: Others
Protein ID: WP_044466380.1
Type: Others
Protein ID: WP_044466380.1
Location: 2031062..2031427 (366 bp)
Type: Others
Protein ID: WP_044466382.1
Type: Others
Protein ID: WP_044466382.1
Location: 2031572..2031841 (270 bp)
Type: Toxin
Protein ID: WP_044466383.1
Type: Toxin
Protein ID: WP_044466383.1
Location: 2031834..2032091 (258 bp)
Type: Antitoxin
Protein ID: WP_037541721.1
Type: Antitoxin
Protein ID: WP_037541721.1
Location: 2033253..2034893 (1641 bp)
Type: Others
Protein ID: WP_170080899.1
Type: Others
Protein ID: WP_170080899.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HHJ99_RS09875 | 2028296..2029054 | + | 759 | WP_044466379.1 | tributyrin esterase | - |
| HHJ99_RS09880 | 2029323..2029634 | - | 312 | WP_044466380.1 | SdpI family protein | - |
| HHJ99_RS09885 | 2029872..2031011 | + | 1140 | WP_044466381.1 | CapA family protein | - |
| HHJ99_RS09890 | 2031062..2031427 | - | 366 | WP_044466382.1 | DUF4870 domain-containing protein | - |
| HHJ99_RS09895 | 2031572..2031841 | - | 270 | WP_044466383.1 | Txe/YoeB family addiction module toxin | Toxin |
| HHJ99_RS09900 | 2031834..2032091 | - | 258 | WP_037541721.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| HHJ99_RS09905 | 2032281..2033138 | + | 858 | WP_044466384.1 | ABC transporter substrate-binding protein | - |
| HHJ99_RS09910 | 2033253..2034893 | - | 1641 | WP_170080899.1 | alpha-keto acid decarboxylase family protein | - |
| HHJ99_RS09915 | 2035065..2035511 | + | 447 | WP_002444594.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| No matching records found | |||||||
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10565.23 Da Isoelectric Point: 10.1797
>T154593 WP_044466383.1 NZ_CP051643:c2031841-2031572 [Staphylococcus caprae]
MNKLNVTFTTRAFKDYQFWQQHNLGNFKKINTLLKSIARDGCIEGIGKPEALKGNYEGYYSRRITIEHRLVYKIKNDSIF
IVSCRFHYL
MNKLNVTFTTRAFKDYQFWQQHNLGNFKKINTLLKSIARDGCIEGIGKPEALKGNYEGYYSRRITIEHRLVYKIKNDSIF
IVSCRFHYL
Download Length: 270 bp
>T154593 NZ_CP068153:34941-35093 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGTACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGTACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 86 a.a. Molecular weight: 9694.68 Da Isoelectric Point: 4.1677
>AT154593 WP_037541721.1 NZ_CP051643:c2032091-2031834 [Staphylococcus caprae]
MPSINYSNARQNFKELISKVNEDSVTYTITTKEDKNAVILAEKDYNAILETMYLQSNPANVSHLNKSIQELNQNDTITVE
IDDNE
MPSINYSNARQNFKELISKVNEDSVTYTITTKEDKNAVILAEKDYNAILETMYLQSNPANVSHLNKSIQELNQNDTITVE
IDDNE
Download Length: 258 bp
>AT154593 NZ_CP068153:c34891-34829 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT