Detailed information of TA system TA154457

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/Ldr(toxin)
• Location: 4991496..4991717
• Replicon: chromosome
• Accession: NZ_CP051609
• Organism: Escherichia coli O25b:H4-ST131 strain 2019_APHA

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: A0A1U9U3P9
• Locus tag: HHM37_RS24000
• Protein ID: WP_001531632.1
• Coordinates: 4991496..4991603 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	-
Coordinates	4991651..4991717 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
HHM37_RS23975	4987340..4988422	+	1083	WP_000804726.1	peptide chain release factor 1	-
HHM37_RS23980	4988422..4989255	+	834	WP_000456450.1	peptide chain release factor N(5)-glutamine methyltransferase	-
HHM37_RS23985	4989252..4989644	+	393	WP_000200375.1	invasion regulator SirB2	-
HHM37_RS23990	4989648..4990457	+	810	WP_001257044.1	invasion regulator SirB1	-
HHM37_RS23995	4990493..4991347	+	855	WP_000811065.1	3-deoxy-8-phosphooctulonate synthase	-
HHM37_RS24000	4991496..4991603	-	108	WP_001531632.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	4991651..4991717	+	67	NuclAT_10	-	Antitoxin
-	4991651..4991717	+	67	NuclAT_10	-	Antitoxin
-	4991651..4991717	+	67	NuclAT_10	-	Antitoxin
-	4991651..4991717	+	67	NuclAT_10	-	Antitoxin
-	4991651..4991717	+	67	NuclAT_5	-	Antitoxin
-	4991651..4991717	+	67	NuclAT_5	-	Antitoxin
-	4991651..4991717	+	67	NuclAT_5	-	Antitoxin
-	4991651..4991717	+	67	NuclAT_5	-	Antitoxin
-	4991651..4991717	+	67	NuclAT_6	-	Antitoxin
-	4991651..4991717	+	67	NuclAT_6	-	Antitoxin
-	4991651..4991717	+	67	NuclAT_6	-	Antitoxin
-	4991651..4991717	+	67	NuclAT_6	-	Antitoxin
-	4991651..4991717	+	67	NuclAT_7	-	Antitoxin
-	4991651..4991717	+	67	NuclAT_7	-	Antitoxin
-	4991651..4991717	+	67	NuclAT_7	-	Antitoxin
-	4991651..4991717	+	67	NuclAT_7	-	Antitoxin
-	4991651..4991717	+	67	NuclAT_8	-	Antitoxin
-	4991651..4991717	+	67	NuclAT_8	-	Antitoxin
-	4991651..4991717	+	67	NuclAT_8	-	Antitoxin
-	4991651..4991717	+	67	NuclAT_8	-	Antitoxin
-	4991651..4991717	+	67	NuclAT_9	-	Antitoxin
-	4991651..4991717	+	67	NuclAT_9	-	Antitoxin
-	4991651..4991717	+	67	NuclAT_9	-	Antitoxin
-	4991651..4991717	+	67	NuclAT_9	-	Antitoxin
-	4991653..4991716	+	64	NuclAT_12	-	-
-	4991653..4991716	+	64	NuclAT_12	-	-
-	4991653..4991716	+	64	NuclAT_12	-	-
-	4991653..4991716	+	64	NuclAT_12	-	-
-	4991653..4991716	+	64	NuclAT_13	-	-
-	4991653..4991716	+	64	NuclAT_13	-	-
-	4991653..4991716	+	64	NuclAT_13	-	-
-	4991653..4991716	+	64	NuclAT_13	-	-
-	4991653..4991716	+	64	NuclAT_14	-	-
-	4991653..4991716	+	64	NuclAT_14	-	-
-	4991653..4991716	+	64	NuclAT_14	-	-
-	4991653..4991716	+	64	NuclAT_14	-	-
-	4991653..4991716	+	64	NuclAT_15	-	-
-	4991653..4991716	+	64	NuclAT_15	-	-
-	4991653..4991716	+	64	NuclAT_15	-	-
-	4991653..4991716	+	64	NuclAT_15	-	-
-	4991653..4991716	+	64	NuclAT_16	-	-
-	4991653..4991716	+	64	NuclAT_16	-	-
-	4991653..4991716	+	64	NuclAT_16	-	-
-	4991653..4991716	+	64	NuclAT_16	-	-
-	4991653..4991716	+	64	NuclAT_17	-	-
-	4991653..4991716	+	64	NuclAT_17	-	-
-	4991653..4991716	+	64	NuclAT_17	-	-
-	4991653..4991716	+	64	NuclAT_17	-	-
-	4991653..4991718	+	66	NuclAT_18	-	-
-	4991653..4991718	+	66	NuclAT_18	-	-
-	4991653..4991718	+	66	NuclAT_18	-	-
-	4991653..4991718	+	66	NuclAT_18	-	-
-	4991653..4991718	+	66	NuclAT_19	-	-
-	4991653..4991718	+	66	NuclAT_19	-	-
-	4991653..4991718	+	66	NuclAT_19	-	-
-	4991653..4991718	+	66	NuclAT_19	-	-
-	4991653..4991718	+	66	NuclAT_20	-	-
-	4991653..4991718	+	66	NuclAT_20	-	-
-	4991653..4991718	+	66	NuclAT_20	-	-
-	4991653..4991718	+	66	NuclAT_20	-	-
-	4991653..4991718	+	66	NuclAT_21	-	-
-	4991653..4991718	+	66	NuclAT_21	-	-
-	4991653..4991718	+	66	NuclAT_21	-	-
-	4991653..4991718	+	66	NuclAT_21	-	-
-	4991653..4991718	+	66	NuclAT_22	-	-
-	4991653..4991718	+	66	NuclAT_22	-	-
-	4991653..4991718	+	66	NuclAT_22	-	-
-	4991653..4991718	+	66	NuclAT_22	-	-
-	4991653..4991718	+	66	NuclAT_23	-	-
-	4991653..4991718	+	66	NuclAT_23	-	-
-	4991653..4991718	+	66	NuclAT_23	-	-
-	4991653..4991718	+	66	NuclAT_23	-	-
HHM37_RS24005	4992008..4993108	-	1101	WP_000063608.1	sodium-potassium/proton antiporter ChaA	-
HHM37_RS24010	4993378..4993617	+	240	WP_000120702.1	putative cation transport regulator ChaB	-
HHM37_RS24015	4993766..4994461	+	696	WP_001295621.1	glutathione-specific gamma-glutamylcyclotransferase	-
HHM37_RS24020	4994505..4994858	-	354	WP_001169659.1	DsrE/F sulfur relay family protein YchN	-
HHM37_RS24025	4995043..4996437	+	1395	WP_000086187.1	inverse autotransporter invasin YchO	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 4040.89 Da
• Isoelectric Point: 12.5163

>T154457 WP_001531632.1 NZ_CP051609:c4991603-4991496 [Escherichia coli O25b:H4-ST131]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Nucleotide

• Length: 108 bp

>T154457 NZ_CP068069:824472-824693 [Staphylococcus equorum]
ATGGATGTAAAAGTAACAGTAATCGTAAGAGTATTAAGTTTAATTTTGGTGTTAGTGAACCAGTGGTTGTCAAATAAAGA
AGTGAGTCCTATTCCAGTGGATGAGTCAACACTAATGACTATCGCAGTCGCATTAATCACGATGTGGAAAGATAACCCAT
TTACAGATGCAGCTAAGGGTTCTTTTTTTAAATCTTATACTTATCAGCTTGAAATATTTTGA

Antitoxin

Nucleotide

• Length: 67 bp

>AT154457 NZ_CP051609:4991651-4991717 [Escherichia coli O25b:H4-ST131]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Structures

Toxin

• AlphaFold DB: A0A1U9U3P9

Antitoxin