Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | fst-RNAII/- |
| Location | 300232..300427 | Replicon | chromosome |
| Accession | NZ_CP051005 | ||
| Organism | Enterococcus faecalis strain TH4125 | ||
Toxin (Protein)
| Gene name | fst | Uniprot ID | - |
| Locus tag | GRB94_RS01520 | Protein ID | WP_015543884.1 |
| Coordinates | 300332..300427 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | RNAII | ||
| Locus tag | - | ||
| Coordinates | 300232..300297 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GRB94_RS01505 | 295863..297605 | + | 1743 | WP_002401739.1 | PTS transporter subunit EIIC | - |
| GRB94_RS01505 | 295863..297605 | + | 1743 | WP_002401739.1 | PTS transporter subunit EIIC | - |
| GRB94_RS01510 | 297596..299629 | + | 2034 | WP_002355275.1 | transcription antiterminator | - |
| GRB94_RS01510 | 297596..299629 | + | 2034 | WP_002355275.1 | transcription antiterminator | - |
| GRB94_RS01515 | 299640..300074 | + | 435 | WP_002355276.1 | PTS sugar transporter subunit IIA | - |
| GRB94_RS01515 | 299640..300074 | + | 435 | WP_002355276.1 | PTS sugar transporter subunit IIA | - |
| - | 300232..300297 | + | 66 | - | - | Antitoxin |
| GRB94_RS01520 | 300332..300427 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| GRB94_RS01520 | 300332..300427 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| GRB94_RS01525 | 300673..302445 | + | 1773 | WP_002391520.1 | PTS mannitol transporter subunit IICBA | - |
| GRB94_RS01525 | 300673..302445 | + | 1773 | WP_002391520.1 | PTS mannitol transporter subunit IICBA | - |
| GRB94_RS01530 | 302460..302897 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
| GRB94_RS01530 | 302460..302897 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
| GRB94_RS01535 | 302912..304066 | + | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
| GRB94_RS01535 | 302912..304066 | + | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
| GRB94_RS01540 | 304135..305250 | - | 1116 | WP_002377910.1 | FAD-binding oxidoreductase | - |
| GRB94_RS01540 | 304135..305250 | - | 1116 | WP_002377910.1 | FAD-binding oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T153529 WP_015543884.1 NZ_CP051005:c300427-300332 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
>T153529 NZ_CP066947:c4709156-4709004 [Xanthomonas campestris pv. campestris]
ATGAAGCGACTGCTGACACTGATGGTGCTGGGCCTGTTCTCGGCCGGCATGATGACTGGCTGTAACACCATGGCTGGTGC
CGGAAAGGACATGCAGGGTGCGGGTGACAAGGTCGAGAAGACCGCCGACAAATGCAGCGACGGTAAGTGCTAA
ATGAAGCGACTGCTGACACTGATGGTGCTGGGCCTGTTCTCGGCCGGCATGATGACTGGCTGTAACACCATGGCTGGTGC
CGGAAAGGACATGCAGGGTGCGGGTGACAAGGTCGAGAAGACCGCCGACAAATGCAGCGACGGTAAGTGCTAA
Antitoxin
Download Length: 66 bp
>AT153529 NZ_CP051005:300232-300297 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|