Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 1160018..1160712 | Replicon | chromosome |
| Accession | NZ_CP050854 | ||
| Organism | Brenneria izadpanahii strain Iran 50 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | - |
| Locus tag | HC231_RS05135 | Protein ID | WP_281397389.1 |
| Coordinates | 1160308..1160712 (+) | Length | 135 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | - |
| Locus tag | HC231_RS05130 | Protein ID | WP_027711146.1 |
| Coordinates | 1160018..1160311 (+) | Length | 98 a.a. |
Genomic Context
Location: 1155560..1155784 (225 bp)
Type: Others
Protein ID: WP_208230017.1
Type: Others
Protein ID: WP_208230017.1
Location: 1157736..1158683 (948 bp)
Type: Others
Protein ID: WP_208230019.1
Type: Others
Protein ID: WP_208230019.1
Location: 1159009..1159611 (603 bp)
Type: Others
Protein ID: WP_208231227.1
Type: Others
Protein ID: WP_208231227.1
Location: 1160018..1160311 (294 bp)
Type: Antitoxin
Protein ID: WP_027711146.1
Type: Antitoxin
Protein ID: WP_027711146.1
Location: 1160308..1160712 (405 bp)
Type: Toxin
Protein ID: WP_281397389.1
Type: Toxin
Protein ID: WP_281397389.1
Location: 1161123..1161305 (183 bp)
Type: Others
Protein ID: Protein_1005
Type: Others
Protein ID: Protein_1005
Location: 1161340..1161972 (633 bp)
Type: Others
Protein ID: Protein_1006
Type: Others
Protein ID: Protein_1006
Location: 1163872..1164444 (573 bp)
Type: Others
Protein ID: WP_208230023.1
Type: Others
Protein ID: WP_208230023.1
Location: 1155774..1156976 (1203 bp)
Type: Others
Protein ID: WP_208228152.1
Type: Others
Protein ID: WP_208228152.1
Location: 1157136..1157315 (180 bp)
Type: Others
Protein ID: WP_208230018.1
Type: Others
Protein ID: WP_208230018.1
Location: 1158755..1159009 (255 bp)
Type: Others
Protein ID: Protein_1001
Type: Others
Protein ID: Protein_1001
Location: 1162049..1162411 (363 bp)
Type: Others
Protein ID: WP_208230021.1
Type: Others
Protein ID: WP_208230021.1
Location: 1162487..1163305 (819 bp)
Type: Others
Protein ID: WP_208230022.1
Type: Others
Protein ID: WP_208230022.1
Location: 1164512..1165186 (675 bp)
Type: Others
Protein ID: WP_208230024.1
Type: Others
Protein ID: WP_208230024.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HC231_RS05105 (HC231_05105) | 1155560..1155784 | + | 225 | WP_208230017.1 | hypothetical protein | - |
| HC231_RS05110 (HC231_05110) | 1155774..1156976 | - | 1203 | WP_208228152.1 | IS256 family transposase | - |
| HC231_RS05115 (HC231_05115) | 1157136..1157315 | - | 180 | WP_208230018.1 | hypothetical protein | - |
| HC231_RS05120 (HC231_05120) | 1157736..1158683 | + | 948 | WP_208230019.1 | HNH endonuclease | - |
| HC231_RS23835 | 1158755..1159009 | - | 255 | Protein_1001 | integrase | - |
| HC231_RS05125 (HC231_05125) | 1159009..1159611 | + | 603 | WP_208231227.1 | ubiquinol-cytochrome C chaperone family protein | - |
| HC231_RS05130 (HC231_05130) | 1160018..1160311 | + | 294 | WP_027711146.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| HC231_RS05135 (HC231_05135) | 1160308..1160712 | + | 405 | WP_281397389.1 | type II toxin-antitoxin system YafO family toxin | Toxin |
| HC231_RS23840 | 1161123..1161305 | + | 183 | Protein_1005 | hypothetical protein | - |
| HC231_RS05145 (HC231_05145) | 1161340..1161972 | + | 633 | Protein_1006 | winged helix-turn-helix domain-containing protein | - |
| HC231_RS05150 (HC231_05150) | 1162049..1162411 | - | 363 | WP_208230021.1 | cupin domain-containing protein | - |
| HC231_RS05155 (HC231_05155) | 1162487..1163305 | - | 819 | WP_208230022.1 | AraC family transcriptional regulator | - |
| HC231_RS05160 (HC231_05160) | 1163872..1164444 | + | 573 | WP_208230023.1 | DUF1349 domain-containing protein | - |
| HC231_RS05165 (HC231_05165) | 1164512..1165186 | - | 675 | WP_208230024.1 | MarC family NAAT transporter | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1146069..1163305 | 17236 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15544.85 Da Isoelectric Point: 6.8447
>T153341 WP_281397389.1 NZ_CP050854:1160308-1160712 [Brenneria izadpanahii]
MSIRIFKSALIRQQLSQQELDDLAEDFLSYKKDGVLPDTFGRDAPYDDDRTYPLVKEEQVAHIHLADADAPFPKFLRQFK
RTSDQAHLVYCQGAMDPDAYLLIIILKPEAHKMARNNNHMHKIGMMAEAFRMKH
MSIRIFKSALIRQQLSQQELDDLAEDFLSYKKDGVLPDTFGRDAPYDDDRTYPLVKEEQVAHIHLADADAPFPKFLRQFK
RTSDQAHLVYCQGAMDPDAYLLIIILKPEAHKMARNNNHMHKIGMMAEAFRMKH
Download Length: 405 bp
>T153341 NZ_CP066851:c2882740-2882637 [Salmonella enterica subsp. enterica serovar Heidelberg]
GGCAAGGCGATTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTATTCGGTCTCTTTTT
GGCAAGGCGATTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTATTCGGTCTCTTTTT
Antitoxin
Download Length: 98 a.a. Molecular weight: 10979.44 Da Isoelectric Point: 4.9167
>AT153341 WP_027711146.1 NZ_CP050854:1160018-1160311 [Brenneria izadpanahii]
MERILAEKSINITELRKNPAKYFIDEPVAVLSNNRPAGYMVSAKVFEELIDLLEEKQGRVHTAARFRPSAERLSDIADSG
QKLLQNASDKDLTEFTE
MERILAEKSINITELRKNPAKYFIDEPVAVLSNNRPAGYMVSAKVFEELIDLLEEKQGRVHTAARFRPSAERLSDIADSG
QKLLQNASDKDLTEFTE
Download Length: 294 bp
>AT153341 NZ_CP066851:2882635-2882778 [Salmonella enterica subsp. enterica serovar Heidelberg]
ATAAAAAGAGACCGAATACGATTCCTGTATTCGGTCCAGGGAAATGGCTCTTGGGAGAGAGCCGTGCGCTAAAAGTTGGC
ATTAATGCAGGCTAAATCGCCTTGCCCTTTAAGAATAGATGACGACGCCAGGTTTTCCAGTTTG
ATAAAAAGAGACCGAATACGATTCCTGTATTCGGTCCAGGGAAATGGCTCTTGGGAGAGAGCCGTGCGCTAAAAGTTGGC
ATTAATGCAGGCTAAATCGCCTTGCCCTTTAAGAATAGATGACGACGCCAGGTTTTCCAGTTTG