Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 1493584..1493768 | Replicon | chromosome |
Accession | NZ_CP050690 | ||
Organism | Staphylococcus aureus strain PMB179-1 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | HCU70_RS07175 | Protein ID | WP_000482647.1 |
Coordinates | 1493584..1493691 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 1493708..1493768 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HCU70_RS07150 | 1488956..1489429 | + | 474 | WP_000456492.1 | GyrI-like domain-containing protein | - |
HCU70_RS07155 | 1489552..1490763 | - | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
HCU70_RS07160 | 1490945..1491604 | - | 660 | WP_000831295.1 | hypothetical protein | - |
HCU70_RS07165 | 1491664..1492806 | - | 1143 | WP_001176863.1 | glycerate kinase | - |
HCU70_RS07170 | 1493064..1493450 | + | 387 | WP_000779360.1 | flippase GtxA | - |
HCU70_RS07175 | 1493584..1493691 | + | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 1493708..1493768 | - | 61 | - | - | Antitoxin |
HCU70_RS07180 | 1494395..1496158 | + | 1764 | WP_001064836.1 | ABC transporter ATP-binding protein/permease | - |
HCU70_RS07185 | 1496183..1497916 | + | 1734 | WP_000486496.1 | ABC transporter ATP-binding protein/permease | - |
HCU70_RS07190 | 1498147..1498314 | + | 168 | WP_001792506.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T153095 WP_000482647.1 NZ_CP050690:1493584-1493691 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T153095 NZ_CP066756:2143048-2143151 [Escherichia coli O157:H7]
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT
Antitoxin
Download Length: 61 bp
>AT153095 NZ_CP050690:c1493768-1493708 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|