Detailed information of TA system TA152938

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/Ldr(toxin)
• Location: 975749..975969
• Replicon: chromosome
• Accession: NZ_CP050498
• Organism: Escherichia coli strain RM13322

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: B7LGX8
• Locus tag: HCR07_RS05315
• Protein ID: WP_000170965.1
• Coordinates: 975862..975969 (+)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	-
Coordinates	975749..975815 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
HCR07_RS05290	971028..972422	-	1395	WP_000086212.1	inverse autotransporter invasin YchO	-
HCR07_RS05295	972607..972960	+	354	WP_001169666.1	DsrE/F sulfur relay family protein YchN	-
HCR07_RS05300	973004..973699	-	696	WP_001297117.1	glutathione-specific gamma-glutamylcyclotransferase	-
HCR07_RS05305	973857..974087	-	231	WP_001146442.1	putative cation transport regulator ChaB	-
HCR07_RS05310	974357..975457	+	1101	WP_001295620.1	sodium-potassium/proton antiporter ChaA	-
-	975749..975815	-	67	-	-	Antitoxin
HCR07_RS05315	975862..975969	+	108	WP_000170965.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	976282..976345	-	64	NuclAT_33	-	-
-	976282..976345	-	64	NuclAT_33	-	-
-	976282..976345	-	64	NuclAT_33	-	-
-	976282..976345	-	64	NuclAT_33	-	-
-	976282..976345	-	64	NuclAT_35	-	-
-	976282..976345	-	64	NuclAT_35	-	-
-	976282..976345	-	64	NuclAT_35	-	-
-	976282..976345	-	64	NuclAT_35	-	-
-	976282..976345	-	64	NuclAT_37	-	-
-	976282..976345	-	64	NuclAT_37	-	-
-	976282..976345	-	64	NuclAT_37	-	-
-	976282..976345	-	64	NuclAT_37	-	-
-	976282..976345	-	64	NuclAT_39	-	-
-	976282..976345	-	64	NuclAT_39	-	-
-	976282..976345	-	64	NuclAT_39	-	-
-	976282..976345	-	64	NuclAT_39	-	-
-	976282..976345	-	64	NuclAT_41	-	-
-	976282..976345	-	64	NuclAT_41	-	-
-	976282..976345	-	64	NuclAT_41	-	-
-	976282..976345	-	64	NuclAT_41	-	-
-	976282..976345	-	64	NuclAT_43	-	-
-	976282..976345	-	64	NuclAT_43	-	-
-	976282..976345	-	64	NuclAT_43	-	-
-	976282..976345	-	64	NuclAT_43	-	-
-	976283..976345	-	63	NuclAT_45	-	-
-	976283..976345	-	63	NuclAT_45	-	-
-	976283..976345	-	63	NuclAT_45	-	-
-	976283..976345	-	63	NuclAT_45	-	-
-	976283..976345	-	63	NuclAT_48	-	-
-	976283..976345	-	63	NuclAT_48	-	-
-	976283..976345	-	63	NuclAT_48	-	-
-	976283..976345	-	63	NuclAT_48	-	-
-	976284..976345	-	62	NuclAT_15	-	-
-	976284..976345	-	62	NuclAT_15	-	-
-	976284..976345	-	62	NuclAT_15	-	-
-	976284..976345	-	62	NuclAT_15	-	-
-	976284..976345	-	62	NuclAT_18	-	-
-	976284..976345	-	62	NuclAT_18	-	-
-	976284..976345	-	62	NuclAT_18	-	-
-	976284..976345	-	62	NuclAT_18	-	-
-	976284..976345	-	62	NuclAT_21	-	-
-	976284..976345	-	62	NuclAT_21	-	-
-	976284..976345	-	62	NuclAT_21	-	-
-	976284..976345	-	62	NuclAT_21	-	-
-	976284..976345	-	62	NuclAT_24	-	-
-	976284..976345	-	62	NuclAT_24	-	-
-	976284..976345	-	62	NuclAT_24	-	-
-	976284..976345	-	62	NuclAT_24	-	-
-	976284..976345	-	62	NuclAT_27	-	-
-	976284..976345	-	62	NuclAT_27	-	-
-	976284..976345	-	62	NuclAT_27	-	-
-	976284..976345	-	62	NuclAT_27	-	-
-	976284..976345	-	62	NuclAT_30	-	-
-	976284..976345	-	62	NuclAT_30	-	-
-	976284..976345	-	62	NuclAT_30	-	-
-	976284..976345	-	62	NuclAT_30	-	-
HCR07_RS05320	976398..976505	+	108	WP_000170926.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	976819..976885	-	67	NuclAT_44	-	-
-	976819..976885	-	67	NuclAT_44	-	-
-	976819..976885	-	67	NuclAT_44	-	-
-	976819..976885	-	67	NuclAT_44	-	-
-	976819..976885	-	67	NuclAT_47	-	-
-	976819..976885	-	67	NuclAT_47	-	-
-	976819..976885	-	67	NuclAT_47	-	-
-	976819..976885	-	67	NuclAT_47	-	-
-	976820..976883	-	64	NuclAT_16	-	-
-	976820..976883	-	64	NuclAT_16	-	-
-	976820..976883	-	64	NuclAT_16	-	-
-	976820..976883	-	64	NuclAT_16	-	-
-	976820..976883	-	64	NuclAT_19	-	-
-	976820..976883	-	64	NuclAT_19	-	-
-	976820..976883	-	64	NuclAT_19	-	-
-	976820..976883	-	64	NuclAT_19	-	-
-	976820..976883	-	64	NuclAT_22	-	-
-	976820..976883	-	64	NuclAT_22	-	-
-	976820..976883	-	64	NuclAT_22	-	-
-	976820..976883	-	64	NuclAT_22	-	-
-	976820..976883	-	64	NuclAT_25	-	-
-	976820..976883	-	64	NuclAT_25	-	-
-	976820..976883	-	64	NuclAT_25	-	-
-	976820..976883	-	64	NuclAT_25	-	-
-	976820..976883	-	64	NuclAT_28	-	-
-	976820..976883	-	64	NuclAT_28	-	-
-	976820..976883	-	64	NuclAT_28	-	-
-	976820..976883	-	64	NuclAT_28	-	-
-	976820..976883	-	64	NuclAT_31	-	-
-	976820..976883	-	64	NuclAT_31	-	-
-	976820..976883	-	64	NuclAT_31	-	-
-	976820..976883	-	64	NuclAT_31	-	-
HCR07_RS05325	976933..977040	+	108	WP_000170954.1	type I toxin-antitoxin system toxin Ldr family protein	-
HCR07_RS05330	977189..978043	-	855	WP_000811065.1	3-deoxy-8-phosphooctulonate synthase	-
HCR07_RS05335	978079..978888	-	810	WP_001257037.1	invasion regulator SirB1	-
HCR07_RS05340	978892..979284	-	393	WP_000200392.1	invasion regulator SirB2	-
HCR07_RS05345	979281..980114	-	834	WP_000456459.1	peptide chain release factor N(5)-glutamine methyltransferase	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 4001.77 Da
• Isoelectric Point: 11.4779

>T152938 WP_000170965.1 NZ_CP050498:975862-975969 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Nucleotide

• Length: 108 bp

>T152938 NZ_CP066622:218356-218622 [Enterococcus faecium]
ATGAGTAACTATACAGTCGCAATCAAAAACTCTGCGAAAGTGGATTTAAGAAAAATCAAGCAAACGAATTTAAAGAAACA
ATTTGAAGAAGTGATTCAGACATTGAAGGAAGATCCATATATGCCCACGCAGTCTTTTGAAAAGCTGAGACCTACACATG
AAGGCAGATACTCACGCAGGCTGAATAGACAGCATCGAGTGGTTTACAAAGTTGATGAGGAAAATAAAGTTGTAGAAATT
TATTCTGCCTGGACACATTATGAGTGA

Antitoxin

Nucleotide

• Length: 67 bp

>AT152938 NZ_CP050498:c975815-975749 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Structures

Toxin

• AlphaFold DB: A0A0E0Y029

Antitoxin