Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 66216..66485 | Replicon | plasmid p50595_ERM |
| Accession | NZ_CP050372 | ||
| Organism | Klebsiella pneumoniae strain 50595 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | HB637_RS27280 | Protein ID | WP_001312861.1 |
| Coordinates | 66327..66485 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 66216..66281 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HB637_RS27255 | 61985..62512 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| HB637_RS27260 | 62570..62803 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
| HB637_RS27265 | 62864..64828 | + | 1965 | WP_063131970.1 | ParB/RepB/Spo0J family partition protein | - |
| HB637_RS27270 | 64897..65331 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| HB637_RS27275 | 65328..66047 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| - | 66059..66283 | + | 225 | NuclAT_0 | - | - |
| - | 66059..66283 | + | 225 | NuclAT_0 | - | - |
| - | 66059..66283 | + | 225 | NuclAT_0 | - | - |
| - | 66059..66283 | + | 225 | NuclAT_0 | - | - |
| - | 66216..66281 | + | 66 | - | - | Antitoxin |
| HB637_RS27280 | 66327..66485 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| HB637_RS29915 | 66723..67100 | - | 378 | Protein_79 | hypothetical protein | - |
| HB637_RS27295 | 67400..67696 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| HB637_RS27300 | 67807..68628 | + | 822 | WP_001234445.1 | DUF945 domain-containing protein | - |
| HB637_RS27305 | 68925..69527 | - | 603 | WP_000243713.1 | transglycosylase SLT domain-containing protein | - |
| HB637_RS27310 | 69850..70233 | + | 384 | WP_001354030.1 | relaxosome protein TraM | - |
| HB637_RS27315 | 70427..71098 | + | 672 | WP_000283561.1 | conjugal transfer transcriptional regulator TraJ | - |
| HB637_RS27320 | 71235..71462 | + | 228 | WP_000089263.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | erm(B) / mph(A) | - | 1..76387 | 76387 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T152754 WP_001312861.1 NZ_CP050372:66327-66485 [Klebsiella pneumoniae]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T152754 NZ_CP066492:c1972444-1972292 [Staphylococcus aureus]
ATGTCTAAAGACAAAGATCCAAAATTAAATTATCATGAAGAAGAAAACAGTATGGTAACGGATTTTGAAGATTTAAAAGA
ATTAGGTAAAGAAATGGAACAAATCTCTGATCAAAATGATCAAGAAAAAAATTCTGAAGAAGACAGTCAGTAA
ATGTCTAAAGACAAAGATCCAAAATTAAATTATCATGAAGAAGAAAACAGTATGGTAACGGATTTTGAAGATTTAAAAGA
ATTAGGTAAAGAAATGGAACAAATCTCTGATCAAAATGATCAAGAAAAAAATTCTGAAGAAGACAGTCAGTAA
Antitoxin
Download Length: 66 bp
>AT152754 NZ_CP050372:66216-66281 [Klebsiella pneumoniae]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|