Detailed information of TA system TA152046

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/Ldr(toxin)
• Location: 2665736..2665956
• Replicon: chromosome
• Accession: NZ_CP050031
• Organism: Escherichia coli strain 33-6

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: B7LGX8
• Locus tag: G9P48_RS12920
• Protein ID: WP_000170965.1
• Coordinates: 2665849..2665956 (+)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	-
Coordinates	2665736..2665802 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
G9P48_RS12895	2661014..2662408	-	1395	WP_001400233.1	inverse autotransporter invasin YchO	-
G9P48_RS12900	2662594..2662947	+	354	WP_001169669.1	DsrE/F sulfur relay family protein YchN	-
G9P48_RS12905	2662991..2663686	-	696	WP_001297117.1	glutathione-specific gamma-glutamylcyclotransferase	-
G9P48_RS12910	2663844..2664074	-	231	WP_001146444.1	putative cation transport regulator ChaB	-
G9P48_RS12915	2664344..2665444	+	1101	WP_001295620.1	sodium-potassium/proton antiporter ChaA	-
-	2665736..2665802	-	67	-	-	Antitoxin
G9P48_RS12920	2665849..2665956	+	108	WP_000170965.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	2666269..2666336	-	68	NuclAT_26	-	-
-	2666269..2666336	-	68	NuclAT_26	-	-
-	2666269..2666336	-	68	NuclAT_26	-	-
-	2666269..2666336	-	68	NuclAT_26	-	-
-	2666269..2666336	-	68	NuclAT_28	-	-
-	2666269..2666336	-	68	NuclAT_28	-	-
-	2666269..2666336	-	68	NuclAT_28	-	-
-	2666269..2666336	-	68	NuclAT_28	-	-
-	2666269..2666336	-	68	NuclAT_30	-	-
-	2666269..2666336	-	68	NuclAT_30	-	-
-	2666269..2666336	-	68	NuclAT_30	-	-
-	2666269..2666336	-	68	NuclAT_30	-	-
-	2666269..2666336	-	68	NuclAT_32	-	-
-	2666269..2666336	-	68	NuclAT_32	-	-
-	2666269..2666336	-	68	NuclAT_32	-	-
-	2666269..2666336	-	68	NuclAT_32	-	-
-	2666269..2666336	-	68	NuclAT_34	-	-
-	2666269..2666336	-	68	NuclAT_34	-	-
-	2666269..2666336	-	68	NuclAT_34	-	-
-	2666269..2666336	-	68	NuclAT_34	-	-
-	2666269..2666336	-	68	NuclAT_36	-	-
-	2666269..2666336	-	68	NuclAT_36	-	-
-	2666269..2666336	-	68	NuclAT_36	-	-
-	2666269..2666336	-	68	NuclAT_36	-	-
-	2666271..2666336	-	66	NuclAT_13	-	-
-	2666271..2666336	-	66	NuclAT_13	-	-
-	2666271..2666336	-	66	NuclAT_13	-	-
-	2666271..2666336	-	66	NuclAT_13	-	-
-	2666271..2666336	-	66	NuclAT_15	-	-
-	2666271..2666336	-	66	NuclAT_15	-	-
-	2666271..2666336	-	66	NuclAT_15	-	-
-	2666271..2666336	-	66	NuclAT_15	-	-
-	2666271..2666336	-	66	NuclAT_17	-	-
-	2666271..2666336	-	66	NuclAT_17	-	-
-	2666271..2666336	-	66	NuclAT_17	-	-
-	2666271..2666336	-	66	NuclAT_17	-	-
-	2666271..2666336	-	66	NuclAT_19	-	-
-	2666271..2666336	-	66	NuclAT_19	-	-
-	2666271..2666336	-	66	NuclAT_19	-	-
-	2666271..2666336	-	66	NuclAT_19	-	-
-	2666271..2666336	-	66	NuclAT_22	-	-
-	2666271..2666336	-	66	NuclAT_22	-	-
-	2666271..2666336	-	66	NuclAT_22	-	-
-	2666271..2666336	-	66	NuclAT_22	-	-
-	2666271..2666336	-	66	NuclAT_24	-	-
-	2666271..2666336	-	66	NuclAT_24	-	-
-	2666271..2666336	-	66	NuclAT_24	-	-
-	2666271..2666336	-	66	NuclAT_24	-	-
G9P48_RS12925	2666384..2666491	+	108	WP_000170963.1	small toxic polypeptide LdrB	-
G9P48_RS12930	2666638..2667492	-	855	WP_000811065.1	3-deoxy-8-phosphooctulonate synthase	-
G9P48_RS12935	2667528..2668337	-	810	WP_001257044.1	invasion regulator SirB1	-
G9P48_RS12940	2668341..2668733	-	393	WP_001409175.1	invasion regulator SirB2	-
G9P48_RS12945	2668730..2669563	-	834	WP_032177158.1	peptide chain release factor N(5)-glutamine methyltransferase	-
G9P48_RS12950	2669563..2670645	-	1083	WP_000804726.1	peptide chain release factor 1	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 4001.77 Da
• Isoelectric Point: 11.4779

>T152046 WP_000170965.1 NZ_CP050031:2665849-2665956 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Nucleotide

• Length: 108 bp

>T152046 NZ_CP065939:c1165372-1165154 [Enterobacter hormaechei]
ATGTCTGATAAACCATTAACAAAAGTCGATTATTTGATGCGCCTGCGACGCTGCCAGTCAATTGACACCCTCGAACGTGT
TATTGAAAAAAATAAATACGAGCTCTCTGATAATGAACTGGCGGTATTTTATTCAGCTGCCGACCATCGTCTGGCTGAAC
TAACCATGAATAAACTGTATGACAAGATCCCCTCTTCGGTATGGAAATTTGTTCGTTAA

Antitoxin

Nucleotide

• Length: 67 bp

>AT152046 NZ_CP050031:c2665802-2665736 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGTGGTTTTCT

Structures

Toxin

• AlphaFold DB: A0A0E0Y029

Antitoxin