Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 2665736..2665956 | Replicon | chromosome |
| Accession | NZ_CP050031 | ||
| Organism | Escherichia coli strain 33-6 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | B7LGX8 |
| Locus tag | G9P48_RS12920 | Protein ID | WP_000170965.1 |
| Coordinates | 2665849..2665956 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 2665736..2665802 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| G9P48_RS12895 | 2661014..2662408 | - | 1395 | WP_001400233.1 | inverse autotransporter invasin YchO | - |
| G9P48_RS12900 | 2662594..2662947 | + | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
| G9P48_RS12905 | 2662991..2663686 | - | 696 | WP_001297117.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| G9P48_RS12910 | 2663844..2664074 | - | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
| G9P48_RS12915 | 2664344..2665444 | + | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| - | 2665736..2665802 | - | 67 | - | - | Antitoxin |
| G9P48_RS12920 | 2665849..2665956 | + | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 2666269..2666336 | - | 68 | NuclAT_26 | - | - |
| - | 2666269..2666336 | - | 68 | NuclAT_26 | - | - |
| - | 2666269..2666336 | - | 68 | NuclAT_26 | - | - |
| - | 2666269..2666336 | - | 68 | NuclAT_26 | - | - |
| - | 2666269..2666336 | - | 68 | NuclAT_28 | - | - |
| - | 2666269..2666336 | - | 68 | NuclAT_28 | - | - |
| - | 2666269..2666336 | - | 68 | NuclAT_28 | - | - |
| - | 2666269..2666336 | - | 68 | NuclAT_28 | - | - |
| - | 2666269..2666336 | - | 68 | NuclAT_30 | - | - |
| - | 2666269..2666336 | - | 68 | NuclAT_30 | - | - |
| - | 2666269..2666336 | - | 68 | NuclAT_30 | - | - |
| - | 2666269..2666336 | - | 68 | NuclAT_30 | - | - |
| - | 2666269..2666336 | - | 68 | NuclAT_32 | - | - |
| - | 2666269..2666336 | - | 68 | NuclAT_32 | - | - |
| - | 2666269..2666336 | - | 68 | NuclAT_32 | - | - |
| - | 2666269..2666336 | - | 68 | NuclAT_32 | - | - |
| - | 2666269..2666336 | - | 68 | NuclAT_34 | - | - |
| - | 2666269..2666336 | - | 68 | NuclAT_34 | - | - |
| - | 2666269..2666336 | - | 68 | NuclAT_34 | - | - |
| - | 2666269..2666336 | - | 68 | NuclAT_34 | - | - |
| - | 2666269..2666336 | - | 68 | NuclAT_36 | - | - |
| - | 2666269..2666336 | - | 68 | NuclAT_36 | - | - |
| - | 2666269..2666336 | - | 68 | NuclAT_36 | - | - |
| - | 2666269..2666336 | - | 68 | NuclAT_36 | - | - |
| - | 2666271..2666336 | - | 66 | NuclAT_13 | - | - |
| - | 2666271..2666336 | - | 66 | NuclAT_13 | - | - |
| - | 2666271..2666336 | - | 66 | NuclAT_13 | - | - |
| - | 2666271..2666336 | - | 66 | NuclAT_13 | - | - |
| - | 2666271..2666336 | - | 66 | NuclAT_15 | - | - |
| - | 2666271..2666336 | - | 66 | NuclAT_15 | - | - |
| - | 2666271..2666336 | - | 66 | NuclAT_15 | - | - |
| - | 2666271..2666336 | - | 66 | NuclAT_15 | - | - |
| - | 2666271..2666336 | - | 66 | NuclAT_17 | - | - |
| - | 2666271..2666336 | - | 66 | NuclAT_17 | - | - |
| - | 2666271..2666336 | - | 66 | NuclAT_17 | - | - |
| - | 2666271..2666336 | - | 66 | NuclAT_17 | - | - |
| - | 2666271..2666336 | - | 66 | NuclAT_19 | - | - |
| - | 2666271..2666336 | - | 66 | NuclAT_19 | - | - |
| - | 2666271..2666336 | - | 66 | NuclAT_19 | - | - |
| - | 2666271..2666336 | - | 66 | NuclAT_19 | - | - |
| - | 2666271..2666336 | - | 66 | NuclAT_22 | - | - |
| - | 2666271..2666336 | - | 66 | NuclAT_22 | - | - |
| - | 2666271..2666336 | - | 66 | NuclAT_22 | - | - |
| - | 2666271..2666336 | - | 66 | NuclAT_22 | - | - |
| - | 2666271..2666336 | - | 66 | NuclAT_24 | - | - |
| - | 2666271..2666336 | - | 66 | NuclAT_24 | - | - |
| - | 2666271..2666336 | - | 66 | NuclAT_24 | - | - |
| - | 2666271..2666336 | - | 66 | NuclAT_24 | - | - |
| G9P48_RS12925 | 2666384..2666491 | + | 108 | WP_000170963.1 | small toxic polypeptide LdrB | - |
| G9P48_RS12930 | 2666638..2667492 | - | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| G9P48_RS12935 | 2667528..2668337 | - | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| G9P48_RS12940 | 2668341..2668733 | - | 393 | WP_001409175.1 | invasion regulator SirB2 | - |
| G9P48_RS12945 | 2668730..2669563 | - | 834 | WP_032177158.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| G9P48_RS12950 | 2669563..2670645 | - | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4001.77 Da Isoelectric Point: 11.4779
>T152046 WP_000170965.1 NZ_CP050031:2665849-2665956 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T152046 NZ_CP065939:c1165372-1165154 [Enterobacter hormaechei]
ATGTCTGATAAACCATTAACAAAAGTCGATTATTTGATGCGCCTGCGACGCTGCCAGTCAATTGACACCCTCGAACGTGT
TATTGAAAAAAATAAATACGAGCTCTCTGATAATGAACTGGCGGTATTTTATTCAGCTGCCGACCATCGTCTGGCTGAAC
TAACCATGAATAAACTGTATGACAAGATCCCCTCTTCGGTATGGAAATTTGTTCGTTAA
ATGTCTGATAAACCATTAACAAAAGTCGATTATTTGATGCGCCTGCGACGCTGCCAGTCAATTGACACCCTCGAACGTGT
TATTGAAAAAAATAAATACGAGCTCTCTGATAATGAACTGGCGGTATTTTATTCAGCTGCCGACCATCGTCTGGCTGAAC
TAACCATGAATAAACTGTATGACAAGATCCCCTCTTCGGTATGGAAATTTGTTCGTTAA
Antitoxin
Download Length: 67 bp
>AT152046 NZ_CP050031:c2665802-2665736 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGTGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGTGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|