Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2665736..2665956 Replicon chromosome
Accession NZ_CP050031
Organism Escherichia coli strain 33-6

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag G9P48_RS12920 Protein ID WP_000170965.1
Coordinates 2665849..2665956 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2665736..2665802 (-)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
G9P48_RS12895 2661014..2662408 - 1395 WP_001400233.1 inverse autotransporter invasin YchO -
G9P48_RS12900 2662594..2662947 + 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
G9P48_RS12905 2662991..2663686 - 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
G9P48_RS12910 2663844..2664074 - 231 WP_001146444.1 putative cation transport regulator ChaB -
G9P48_RS12915 2664344..2665444 + 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
- 2665736..2665802 - 67 - - Antitoxin
G9P48_RS12920 2665849..2665956 + 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2666269..2666336 - 68 NuclAT_26 - -
- 2666269..2666336 - 68 NuclAT_26 - -
- 2666269..2666336 - 68 NuclAT_26 - -
- 2666269..2666336 - 68 NuclAT_26 - -
- 2666269..2666336 - 68 NuclAT_28 - -
- 2666269..2666336 - 68 NuclAT_28 - -
- 2666269..2666336 - 68 NuclAT_28 - -
- 2666269..2666336 - 68 NuclAT_28 - -
- 2666269..2666336 - 68 NuclAT_30 - -
- 2666269..2666336 - 68 NuclAT_30 - -
- 2666269..2666336 - 68 NuclAT_30 - -
- 2666269..2666336 - 68 NuclAT_30 - -
- 2666269..2666336 - 68 NuclAT_32 - -
- 2666269..2666336 - 68 NuclAT_32 - -
- 2666269..2666336 - 68 NuclAT_32 - -
- 2666269..2666336 - 68 NuclAT_32 - -
- 2666269..2666336 - 68 NuclAT_34 - -
- 2666269..2666336 - 68 NuclAT_34 - -
- 2666269..2666336 - 68 NuclAT_34 - -
- 2666269..2666336 - 68 NuclAT_34 - -
- 2666269..2666336 - 68 NuclAT_36 - -
- 2666269..2666336 - 68 NuclAT_36 - -
- 2666269..2666336 - 68 NuclAT_36 - -
- 2666269..2666336 - 68 NuclAT_36 - -
- 2666271..2666336 - 66 NuclAT_13 - -
- 2666271..2666336 - 66 NuclAT_13 - -
- 2666271..2666336 - 66 NuclAT_13 - -
- 2666271..2666336 - 66 NuclAT_13 - -
- 2666271..2666336 - 66 NuclAT_15 - -
- 2666271..2666336 - 66 NuclAT_15 - -
- 2666271..2666336 - 66 NuclAT_15 - -
- 2666271..2666336 - 66 NuclAT_15 - -
- 2666271..2666336 - 66 NuclAT_17 - -
- 2666271..2666336 - 66 NuclAT_17 - -
- 2666271..2666336 - 66 NuclAT_17 - -
- 2666271..2666336 - 66 NuclAT_17 - -
- 2666271..2666336 - 66 NuclAT_19 - -
- 2666271..2666336 - 66 NuclAT_19 - -
- 2666271..2666336 - 66 NuclAT_19 - -
- 2666271..2666336 - 66 NuclAT_19 - -
- 2666271..2666336 - 66 NuclAT_22 - -
- 2666271..2666336 - 66 NuclAT_22 - -
- 2666271..2666336 - 66 NuclAT_22 - -
- 2666271..2666336 - 66 NuclAT_22 - -
- 2666271..2666336 - 66 NuclAT_24 - -
- 2666271..2666336 - 66 NuclAT_24 - -
- 2666271..2666336 - 66 NuclAT_24 - -
- 2666271..2666336 - 66 NuclAT_24 - -
G9P48_RS12925 2666384..2666491 + 108 WP_000170963.1 small toxic polypeptide LdrB -
G9P48_RS12930 2666638..2667492 - 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
G9P48_RS12935 2667528..2668337 - 810 WP_001257044.1 invasion regulator SirB1 -
G9P48_RS12940 2668341..2668733 - 393 WP_001409175.1 invasion regulator SirB2 -
G9P48_RS12945 2668730..2669563 - 834 WP_032177158.1 peptide chain release factor N(5)-glutamine methyltransferase -
G9P48_RS12950 2669563..2670645 - 1083 WP_000804726.1 peptide chain release factor 1 -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T152046 WP_000170965.1 NZ_CP050031:2665849-2665956 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T152046 NZ_CP065939:c1165372-1165154 [Enterobacter hormaechei]
ATGTCTGATAAACCATTAACAAAAGTCGATTATTTGATGCGCCTGCGACGCTGCCAGTCAATTGACACCCTCGAACGTGT
TATTGAAAAAAATAAATACGAGCTCTCTGATAATGAACTGGCGGTATTTTATTCAGCTGCCGACCATCGTCTGGCTGAAC
TAACCATGAATAAACTGTATGACAAGATCCCCTCTTCGGTATGGAAATTTGTTCGTTAA

Antitoxin


Download         Length: 67 bp

>AT152046 NZ_CP050031:c2665802-2665736 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGTGGTTTTCT

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029


Antitoxin

Download structure file

References