Detailed information of TA system TA151925

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 19296..19550
• Replicon: plasmid pCO_Eco4457-3
• Accession: NZ_CP049970
• Organism: Escherichia coli strain ARL09/232

Toxin (Protein)

• Gene name: srnB
• Uniprot ID: -
• Locus tag: G9448_RS25615
• Protein ID: WP_032215358.1
• Coordinates: 19296..19502 (-)
• Length: 69 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	19489..19550 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
G9448_RS25575	14655..15070	-	416	Protein_16	IS1 family transposase	-
G9448_RS25580	15319..15720	-	402	WP_001398199.1	type II toxin-antitoxin system toxin endoribonuclease PemK	-
G9448_RS25585	15653..15910	-	258	WP_000557619.1	type II toxin-antitoxin system antitoxin PemI	-
G9448_RS25590	16003..16656	-	654	WP_000616807.1	CPBP family intramembrane metalloprotease	-
G9448_RS25595	16754..16894	-	141	WP_001333237.1	hypothetical protein	-
G9448_RS25600	17595..18452	-	858	WP_029702152.1	incFII family plasmid replication initiator RepA	-
G9448_RS25605	18445..18519	-	75	WP_001365705.1	RepA leader peptide Tap	-
G9448_RS25610	18755..19012	-	258	WP_000083833.1	replication regulatory protein RepA	-
G9448_RS25615	19296..19502	-	207	WP_032215358.1	type I toxin-antitoxin system Hok family toxin	Toxin
-	19489..19550	+	62	NuclAT_0	-	Antitoxin
-	19489..19550	+	62	NuclAT_0	-	Antitoxin
-	19489..19550	+	62	NuclAT_0	-	Antitoxin
-	19489..19550	+	62	NuclAT_0	-	Antitoxin
G9448_RS25620	19689..19955	-	267	WP_087757657.1	hypothetical protein	-
G9448_RS25625	20330..20899	-	570	WP_029702150.1	DUF2726 domain-containing protein	-
G9448_RS25630	21051..21677	-	627	WP_029702149.1	hypothetical protein	-
G9448_RS25635	22089..22298	-	210	WP_039023209.1	hypothetical protein	-
G9448_RS25640	22429..22989	-	561	WP_001567328.1	fertility inhibition protein FinO	-
G9448_RS25645	23044..23790	-	747	WP_052273601.1	conjugal transfer pilus acetylase TraX	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	blaTEM-1B	-	1..101847	101847

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (23-64)

Sequences

Toxin

Protein

• Length: 69 a.a.
• Molecular weight: 7778.27 Da
• Isoelectric Point: 8.8807

>T151925 WP_032215358.1 NZ_CP049970:c19502-19296 [Escherichia coli]
MKYLNTTDCSLFLAERSKFMTKYALIGVLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Nucleotide

• Length: 207 bp

>T151925 NZ_CP065838:1864068-1864170 [Klebsiella quasipneumoniae]
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT

Antitoxin

Nucleotide

• Length: 62 bp

>AT151925 NZ_CP049970:19489-19550 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Structures

Antitoxin