Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 769709..769929 Replicon chromosome
Accession NZ_CP049936
Organism Escherichia coli strain JL05

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag G9V97_RS03675 Protein ID WP_000170965.1
Coordinates 769822..769929 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 769709..769775 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
G9V97_RS03650 764988..766382 - 1395 WP_000086201.1 inverse autotransporter invasin YchO -
G9V97_RS03655 766567..766920 + 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
G9V97_RS03660 766964..767659 - 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
G9V97_RS03665 767817..768047 - 231 WP_001146442.1 putative cation transport regulator ChaB -
G9V97_RS03670 768317..769417 + 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
- 769709..769775 - 67 - - Antitoxin
G9V97_RS03675 769822..769929 + 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 770242..770307 - 66 NuclAT_34 - -
- 770242..770307 - 66 NuclAT_34 - -
- 770242..770307 - 66 NuclAT_34 - -
- 770242..770307 - 66 NuclAT_34 - -
- 770242..770307 - 66 NuclAT_37 - -
- 770242..770307 - 66 NuclAT_37 - -
- 770242..770307 - 66 NuclAT_37 - -
- 770242..770307 - 66 NuclAT_37 - -
- 770242..770307 - 66 NuclAT_40 - -
- 770242..770307 - 66 NuclAT_40 - -
- 770242..770307 - 66 NuclAT_40 - -
- 770242..770307 - 66 NuclAT_40 - -
- 770242..770307 - 66 NuclAT_43 - -
- 770242..770307 - 66 NuclAT_43 - -
- 770242..770307 - 66 NuclAT_43 - -
- 770242..770307 - 66 NuclAT_43 - -
- 770242..770307 - 66 NuclAT_46 - -
- 770242..770307 - 66 NuclAT_46 - -
- 770242..770307 - 66 NuclAT_46 - -
- 770242..770307 - 66 NuclAT_46 - -
- 770242..770307 - 66 NuclAT_49 - -
- 770242..770307 - 66 NuclAT_49 - -
- 770242..770307 - 66 NuclAT_49 - -
- 770242..770307 - 66 NuclAT_49 - -
- 770243..770309 - 67 NuclAT_51 - -
- 770243..770309 - 67 NuclAT_51 - -
- 770243..770309 - 67 NuclAT_51 - -
- 770243..770309 - 67 NuclAT_51 - -
- 770243..770309 - 67 NuclAT_54 - -
- 770243..770309 - 67 NuclAT_54 - -
- 770243..770309 - 67 NuclAT_54 - -
- 770243..770309 - 67 NuclAT_54 - -
- 770243..770309 - 67 NuclAT_57 - -
- 770243..770309 - 67 NuclAT_57 - -
- 770243..770309 - 67 NuclAT_57 - -
- 770243..770309 - 67 NuclAT_57 - -
- 770244..770307 - 64 NuclAT_16 - -
- 770244..770307 - 64 NuclAT_16 - -
- 770244..770307 - 64 NuclAT_16 - -
- 770244..770307 - 64 NuclAT_16 - -
- 770244..770307 - 64 NuclAT_19 - -
- 770244..770307 - 64 NuclAT_19 - -
- 770244..770307 - 64 NuclAT_19 - -
- 770244..770307 - 64 NuclAT_19 - -
- 770244..770307 - 64 NuclAT_22 - -
- 770244..770307 - 64 NuclAT_22 - -
- 770244..770307 - 64 NuclAT_22 - -
- 770244..770307 - 64 NuclAT_22 - -
- 770244..770307 - 64 NuclAT_25 - -
- 770244..770307 - 64 NuclAT_25 - -
- 770244..770307 - 64 NuclAT_25 - -
- 770244..770307 - 64 NuclAT_25 - -
- 770244..770307 - 64 NuclAT_28 - -
- 770244..770307 - 64 NuclAT_28 - -
- 770244..770307 - 64 NuclAT_28 - -
- 770244..770307 - 64 NuclAT_28 - -
- 770244..770307 - 64 NuclAT_31 - -
- 770244..770307 - 64 NuclAT_31 - -
- 770244..770307 - 64 NuclAT_31 - -
- 770244..770307 - 64 NuclAT_31 - -
G9V97_RS03680 770357..770464 + 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- 770777..770842 - 66 NuclAT_33 - -
- 770777..770842 - 66 NuclAT_33 - -
- 770777..770842 - 66 NuclAT_33 - -
- 770777..770842 - 66 NuclAT_33 - -
- 770777..770842 - 66 NuclAT_36 - -
- 770777..770842 - 66 NuclAT_36 - -
- 770777..770842 - 66 NuclAT_36 - -
- 770777..770842 - 66 NuclAT_36 - -
- 770777..770842 - 66 NuclAT_39 - -
- 770777..770842 - 66 NuclAT_39 - -
- 770777..770842 - 66 NuclAT_39 - -
- 770777..770842 - 66 NuclAT_39 - -
- 770777..770842 - 66 NuclAT_42 - -
- 770777..770842 - 66 NuclAT_42 - -
- 770777..770842 - 66 NuclAT_42 - -
- 770777..770842 - 66 NuclAT_42 - -
- 770777..770842 - 66 NuclAT_45 - -
- 770777..770842 - 66 NuclAT_45 - -
- 770777..770842 - 66 NuclAT_45 - -
- 770777..770842 - 66 NuclAT_45 - -
- 770777..770842 - 66 NuclAT_48 - -
- 770777..770842 - 66 NuclAT_48 - -
- 770777..770842 - 66 NuclAT_48 - -
- 770777..770842 - 66 NuclAT_48 - -
- 770778..770844 - 67 NuclAT_50 - -
- 770778..770844 - 67 NuclAT_50 - -
- 770778..770844 - 67 NuclAT_50 - -
- 770778..770844 - 67 NuclAT_50 - -
- 770778..770844 - 67 NuclAT_53 - -
- 770778..770844 - 67 NuclAT_53 - -
- 770778..770844 - 67 NuclAT_53 - -
- 770778..770844 - 67 NuclAT_53 - -
- 770778..770844 - 67 NuclAT_56 - -
- 770778..770844 - 67 NuclAT_56 - -
- 770778..770844 - 67 NuclAT_56 - -
- 770778..770844 - 67 NuclAT_56 - -
- 770779..770842 - 64 NuclAT_15 - -
- 770779..770842 - 64 NuclAT_15 - -
- 770779..770842 - 64 NuclAT_15 - -
- 770779..770842 - 64 NuclAT_15 - -
- 770779..770842 - 64 NuclAT_18 - -
- 770779..770842 - 64 NuclAT_18 - -
- 770779..770842 - 64 NuclAT_18 - -
- 770779..770842 - 64 NuclAT_18 - -
- 770779..770842 - 64 NuclAT_21 - -
- 770779..770842 - 64 NuclAT_21 - -
- 770779..770842 - 64 NuclAT_21 - -
- 770779..770842 - 64 NuclAT_21 - -
- 770779..770842 - 64 NuclAT_24 - -
- 770779..770842 - 64 NuclAT_24 - -
- 770779..770842 - 64 NuclAT_24 - -
- 770779..770842 - 64 NuclAT_24 - -
- 770779..770842 - 64 NuclAT_27 - -
- 770779..770842 - 64 NuclAT_27 - -
- 770779..770842 - 64 NuclAT_27 - -
- 770779..770842 - 64 NuclAT_27 - -
- 770779..770842 - 64 NuclAT_30 - -
- 770779..770842 - 64 NuclAT_30 - -
- 770779..770842 - 64 NuclAT_30 - -
- 770779..770842 - 64 NuclAT_30 - -
G9V97_RS03685 770892..770999 + 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
G9V97_RS03690 771148..772002 - 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
G9V97_RS03695 772038..772847 - 810 WP_001257044.1 invasion regulator SirB1 -
G9V97_RS03700 772851..773243 - 393 WP_000200392.1 invasion regulator SirB2 -
G9V97_RS03705 773240..774073 - 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T151789 WP_000170965.1 NZ_CP049936:769822-769929 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T151789 NZ_CP065725:310719-310979 [Oligella ureolytica]
ATGTTTCAAGTTATCTATACAGCAAAAGCATTAAAATCTTTATCAAAGCTAGATAAAACTCAAGCTCGTCTAATTGTCGC
TTGGATTGAAAAAAATTTAGTTAATAGCTCTAATCCTCGGTTTACAGGGAAAAATATTAAAGGGGATTTAGCTGATTGGA
GATATCGTGTTGGCAATTACCGCATCTTATGCCACATTATTGATCAAACTATAACCATTGAAGTTGTTAATATTGGTCAT
CGAAAAGATATCTATAAATGA

Antitoxin


Download         Length: 67 bp

>AT151789 NZ_CP049936:c769775-769709 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References