Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-sokW/Ldr(toxin)
Location 1829068..1829288 Replicon chromosome
Accession NZ_CP049606
Organism Shigella boydii strain 600080

Toxin (Protein)


Gene name ldrD Uniprot ID A0A4P7TT65
Locus tag G5S61_RS09135 Protein ID WP_000170961.1
Coordinates 1829068..1829175 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 1829223..1829288 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
G5S61_RS09110 (1824850) 1824850..1825242 + 393 WP_039065994.1 invasion regulator SirB2 -
G5S61_RS09115 (1825246) 1825246..1826056 + 811 Protein_1806 invasion regulator SirB1 -
G5S61_RS09120 (1826092) 1826092..1826946 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
G5S61_RS09125 (1827095) 1827095..1827202 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1827252) 1827252..1827306 + 55 NuclAT_17 - -
- (1827252) 1827252..1827306 + 55 NuclAT_17 - -
- (1827252) 1827252..1827306 + 55 NuclAT_17 - -
- (1827252) 1827252..1827306 + 55 NuclAT_17 - -
- (1827252) 1827252..1827306 + 55 NuclAT_19 - -
- (1827252) 1827252..1827306 + 55 NuclAT_19 - -
- (1827252) 1827252..1827306 + 55 NuclAT_19 - -
- (1827252) 1827252..1827306 + 55 NuclAT_19 - -
- (1827252) 1827252..1827306 + 55 NuclAT_21 - -
- (1827252) 1827252..1827306 + 55 NuclAT_21 - -
- (1827252) 1827252..1827306 + 55 NuclAT_21 - -
- (1827252) 1827252..1827306 + 55 NuclAT_21 - -
- (1827252) 1827252..1827306 + 55 NuclAT_23 - -
- (1827252) 1827252..1827306 + 55 NuclAT_23 - -
- (1827252) 1827252..1827306 + 55 NuclAT_23 - -
- (1827252) 1827252..1827306 + 55 NuclAT_23 - -
- (1827252) 1827252..1827306 + 55 NuclAT_25 - -
- (1827252) 1827252..1827306 + 55 NuclAT_25 - -
- (1827252) 1827252..1827306 + 55 NuclAT_25 - -
- (1827252) 1827252..1827306 + 55 NuclAT_25 - -
- (1827252) 1827252..1827306 + 55 NuclAT_27 - -
- (1827252) 1827252..1827306 + 55 NuclAT_27 - -
- (1827252) 1827252..1827306 + 55 NuclAT_27 - -
- (1827252) 1827252..1827306 + 55 NuclAT_27 - -
G5S61_RS09130 (1827320) 1827320..1828666 - 1347 WP_178986822.1 IS4-like element IS4 family transposase -
G5S61_RS09135 (1829068) 1829068..1829175 - 108 WP_000170961.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (1829223) 1829223..1829288 + 66 NuclAT_16 - Antitoxin
- (1829223) 1829223..1829288 + 66 NuclAT_16 - Antitoxin
- (1829223) 1829223..1829288 + 66 NuclAT_16 - Antitoxin
- (1829223) 1829223..1829288 + 66 NuclAT_16 - Antitoxin
- (1829223) 1829223..1829288 + 66 NuclAT_18 - Antitoxin
- (1829223) 1829223..1829288 + 66 NuclAT_18 - Antitoxin
- (1829223) 1829223..1829288 + 66 NuclAT_18 - Antitoxin
- (1829223) 1829223..1829288 + 66 NuclAT_18 - Antitoxin
- (1829223) 1829223..1829288 + 66 NuclAT_20 - Antitoxin
- (1829223) 1829223..1829288 + 66 NuclAT_20 - Antitoxin
- (1829223) 1829223..1829288 + 66 NuclAT_20 - Antitoxin
- (1829223) 1829223..1829288 + 66 NuclAT_20 - Antitoxin
- (1829223) 1829223..1829288 + 66 NuclAT_22 - Antitoxin
- (1829223) 1829223..1829288 + 66 NuclAT_22 - Antitoxin
- (1829223) 1829223..1829288 + 66 NuclAT_22 - Antitoxin
- (1829223) 1829223..1829288 + 66 NuclAT_22 - Antitoxin
- (1829223) 1829223..1829288 + 66 NuclAT_24 - Antitoxin
- (1829223) 1829223..1829288 + 66 NuclAT_24 - Antitoxin
- (1829223) 1829223..1829288 + 66 NuclAT_24 - Antitoxin
- (1829223) 1829223..1829288 + 66 NuclAT_24 - Antitoxin
- (1829223) 1829223..1829288 + 66 NuclAT_26 - Antitoxin
- (1829223) 1829223..1829288 + 66 NuclAT_26 - Antitoxin
- (1829223) 1829223..1829288 + 66 NuclAT_26 - Antitoxin
- (1829223) 1829223..1829288 + 66 NuclAT_26 - Antitoxin
- (1829223) 1829223..1829290 + 68 NuclAT_10 - -
- (1829223) 1829223..1829290 + 68 NuclAT_10 - -
- (1829223) 1829223..1829290 + 68 NuclAT_10 - -
- (1829223) 1829223..1829290 + 68 NuclAT_10 - -
- (1829223) 1829223..1829290 + 68 NuclAT_11 - -
- (1829223) 1829223..1829290 + 68 NuclAT_11 - -
- (1829223) 1829223..1829290 + 68 NuclAT_11 - -
- (1829223) 1829223..1829290 + 68 NuclAT_11 - -
- (1829223) 1829223..1829290 + 68 NuclAT_12 - -
- (1829223) 1829223..1829290 + 68 NuclAT_12 - -
- (1829223) 1829223..1829290 + 68 NuclAT_12 - -
- (1829223) 1829223..1829290 + 68 NuclAT_12 - -
- (1829223) 1829223..1829290 + 68 NuclAT_13 - -
- (1829223) 1829223..1829290 + 68 NuclAT_13 - -
- (1829223) 1829223..1829290 + 68 NuclAT_13 - -
- (1829223) 1829223..1829290 + 68 NuclAT_13 - -
- (1829223) 1829223..1829290 + 68 NuclAT_14 - -
- (1829223) 1829223..1829290 + 68 NuclAT_14 - -
- (1829223) 1829223..1829290 + 68 NuclAT_14 - -
- (1829223) 1829223..1829290 + 68 NuclAT_14 - -
- (1829223) 1829223..1829290 + 68 NuclAT_15 - -
- (1829223) 1829223..1829290 + 68 NuclAT_15 - -
- (1829223) 1829223..1829290 + 68 NuclAT_15 - -
- (1829223) 1829223..1829290 + 68 NuclAT_15 - -
G5S61_RS09140 (1829580) 1829580..1830680 - 1101 WP_000063614.1 sodium-potassium/proton antiporter ChaA -
G5S61_RS09145 (1830950) 1830950..1831180 + 231 WP_001146444.1 putative cation transport regulator ChaB -
G5S61_RS09150 (1831338) 1831338..1832033 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
G5S61_RS09155 (1832077) 1832077..1832430 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
G5S61_RS09160 (1832615) 1832615..1834009 + 1395 WP_000086222.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 1827320..1828648 1328


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T151364 WP_000170961.1 NZ_CP049606:c1829175-1829068 [Shigella boydii]
MTLAQFAMTFWHDLAAPILAGIIAAAIVSWWRNRK

Download         Length: 108 bp

>T151364 NZ_CP065447:c3674873-3673956 [Klebsiella pneumoniae]
ATGGATATACAGGCGCCTTATTATCGGCAGGTTGCTCTGCTAATGCAGGTTTTACCCTATGTTGCTGTCGAACGGGAATT
TGCGCTGAAAGGTGGCACTGCCATCAATCTCTTTATCCGCGATTTCCCTCGATTATCGGTGGATATCGACCTCGCCTGGG
TGCCCCTGGAAAGCAGAGCCATCGCTTTACCTCATATACGGGATGCGCTTGCACGTATTGCCGCCAATCTGCAACAACAG
GCAGGTATGAGCGCTGTATTACAAGCTAATCGTTCAGATGAGATGCGTGTCATTGTTACTACCGATAGCGCGCAAATAAA
GATAGAGGTTTCACCGGTCGCCCGGGGAACATTATATCCACCACAGGAGCGAGAAGTGGTGGGGGCGGTAGAGGACGTTT
TTGGCTATGCCAGCCTTCCAGTGGTTTCGTTGCCTGACCTCTACGGTGGAAAATTATGCGCGGCGCTGGATCGCCAGCAT
CCCAGAGATTTTTATGACGTGAAATTACTTCTTGATGCGCAGGAGCTTGACCGTCCCATTTTCAATGGGTTTATCGTGTA
TTTACTGAGCCATAATCGGCCTCTGGCTGAAGTGCTGAATCCTCGCTGGAAAGATATTGCTGAACCTTTTTACCGTGAAT
TCAGCGGGATGACATTTGAGACGATAGCCCTGGAGGAACTGACAGCAGTCCCCAACAGGATGATTGCTGCGTTAAAATCC
TGTTTCACACAACAGGATGTCGATTTTTTACTGTCATTTAAACGAGGCGAACCAGACTGGCGTTTAGCGCCGGAAATGCG
TATTCAGGATTTGCCTGCCGTGCAGTGGAAATTGCGCAATATTCATCAGATGCCAGCGATAAAACGCGCTGAGTCATTAG
ATAAACTGGAAAAGGTGCTGGCCGAGTGGCGCAGTTAG

Antitoxin


Download         Length: 66 bp

>AT151364 NZ_CP049606:1829223-1829288 [Shigella boydii]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TT65

Antitoxin

Download structure file

References