Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1827095..1827306 Replicon chromosome
Accession NZ_CP049606
Organism Shigella boydii strain 600080

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag G5S61_RS09125 Protein ID WP_000170954.1
Coordinates 1827095..1827202 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1827252..1827306 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
G5S61_RS09100 (1822938) 1822938..1824020 + 1083 WP_039065993.1 peptide chain release factor 1 -
G5S61_RS09105 (1824020) 1824020..1824853 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
G5S61_RS09110 (1824850) 1824850..1825242 + 393 WP_039065994.1 invasion regulator SirB2 -
G5S61_RS09115 (1825246) 1825246..1826056 + 811 Protein_1806 invasion regulator SirB1 -
G5S61_RS09120 (1826092) 1826092..1826946 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
G5S61_RS09125 (1827095) 1827095..1827202 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (1827252) 1827252..1827306 + 55 NuclAT_17 - Antitoxin
- (1827252) 1827252..1827306 + 55 NuclAT_17 - Antitoxin
- (1827252) 1827252..1827306 + 55 NuclAT_17 - Antitoxin
- (1827252) 1827252..1827306 + 55 NuclAT_17 - Antitoxin
- (1827252) 1827252..1827306 + 55 NuclAT_19 - Antitoxin
- (1827252) 1827252..1827306 + 55 NuclAT_19 - Antitoxin
- (1827252) 1827252..1827306 + 55 NuclAT_19 - Antitoxin
- (1827252) 1827252..1827306 + 55 NuclAT_19 - Antitoxin
- (1827252) 1827252..1827306 + 55 NuclAT_21 - Antitoxin
- (1827252) 1827252..1827306 + 55 NuclAT_21 - Antitoxin
- (1827252) 1827252..1827306 + 55 NuclAT_21 - Antitoxin
- (1827252) 1827252..1827306 + 55 NuclAT_21 - Antitoxin
- (1827252) 1827252..1827306 + 55 NuclAT_23 - Antitoxin
- (1827252) 1827252..1827306 + 55 NuclAT_23 - Antitoxin
- (1827252) 1827252..1827306 + 55 NuclAT_23 - Antitoxin
- (1827252) 1827252..1827306 + 55 NuclAT_23 - Antitoxin
- (1827252) 1827252..1827306 + 55 NuclAT_25 - Antitoxin
- (1827252) 1827252..1827306 + 55 NuclAT_25 - Antitoxin
- (1827252) 1827252..1827306 + 55 NuclAT_25 - Antitoxin
- (1827252) 1827252..1827306 + 55 NuclAT_25 - Antitoxin
- (1827252) 1827252..1827306 + 55 NuclAT_27 - Antitoxin
- (1827252) 1827252..1827306 + 55 NuclAT_27 - Antitoxin
- (1827252) 1827252..1827306 + 55 NuclAT_27 - Antitoxin
- (1827252) 1827252..1827306 + 55 NuclAT_27 - Antitoxin
G5S61_RS09130 (1827320) 1827320..1828666 - 1347 WP_178986822.1 IS4-like element IS4 family transposase -
G5S61_RS09135 (1829068) 1829068..1829175 - 108 WP_000170961.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1829223) 1829223..1829288 + 66 NuclAT_16 - -
- (1829223) 1829223..1829288 + 66 NuclAT_16 - -
- (1829223) 1829223..1829288 + 66 NuclAT_16 - -
- (1829223) 1829223..1829288 + 66 NuclAT_16 - -
- (1829223) 1829223..1829288 + 66 NuclAT_18 - -
- (1829223) 1829223..1829288 + 66 NuclAT_18 - -
- (1829223) 1829223..1829288 + 66 NuclAT_18 - -
- (1829223) 1829223..1829288 + 66 NuclAT_18 - -
- (1829223) 1829223..1829288 + 66 NuclAT_20 - -
- (1829223) 1829223..1829288 + 66 NuclAT_20 - -
- (1829223) 1829223..1829288 + 66 NuclAT_20 - -
- (1829223) 1829223..1829288 + 66 NuclAT_20 - -
- (1829223) 1829223..1829288 + 66 NuclAT_22 - -
- (1829223) 1829223..1829288 + 66 NuclAT_22 - -
- (1829223) 1829223..1829288 + 66 NuclAT_22 - -
- (1829223) 1829223..1829288 + 66 NuclAT_22 - -
- (1829223) 1829223..1829288 + 66 NuclAT_24 - -
- (1829223) 1829223..1829288 + 66 NuclAT_24 - -
- (1829223) 1829223..1829288 + 66 NuclAT_24 - -
- (1829223) 1829223..1829288 + 66 NuclAT_24 - -
- (1829223) 1829223..1829288 + 66 NuclAT_26 - -
- (1829223) 1829223..1829288 + 66 NuclAT_26 - -
- (1829223) 1829223..1829288 + 66 NuclAT_26 - -
- (1829223) 1829223..1829288 + 66 NuclAT_26 - -
- (1829223) 1829223..1829290 + 68 NuclAT_10 - -
- (1829223) 1829223..1829290 + 68 NuclAT_10 - -
- (1829223) 1829223..1829290 + 68 NuclAT_10 - -
- (1829223) 1829223..1829290 + 68 NuclAT_10 - -
- (1829223) 1829223..1829290 + 68 NuclAT_11 - -
- (1829223) 1829223..1829290 + 68 NuclAT_11 - -
- (1829223) 1829223..1829290 + 68 NuclAT_11 - -
- (1829223) 1829223..1829290 + 68 NuclAT_11 - -
- (1829223) 1829223..1829290 + 68 NuclAT_12 - -
- (1829223) 1829223..1829290 + 68 NuclAT_12 - -
- (1829223) 1829223..1829290 + 68 NuclAT_12 - -
- (1829223) 1829223..1829290 + 68 NuclAT_12 - -
- (1829223) 1829223..1829290 + 68 NuclAT_13 - -
- (1829223) 1829223..1829290 + 68 NuclAT_13 - -
- (1829223) 1829223..1829290 + 68 NuclAT_13 - -
- (1829223) 1829223..1829290 + 68 NuclAT_13 - -
- (1829223) 1829223..1829290 + 68 NuclAT_14 - -
- (1829223) 1829223..1829290 + 68 NuclAT_14 - -
- (1829223) 1829223..1829290 + 68 NuclAT_14 - -
- (1829223) 1829223..1829290 + 68 NuclAT_14 - -
- (1829223) 1829223..1829290 + 68 NuclAT_15 - -
- (1829223) 1829223..1829290 + 68 NuclAT_15 - -
- (1829223) 1829223..1829290 + 68 NuclAT_15 - -
- (1829223) 1829223..1829290 + 68 NuclAT_15 - -
G5S61_RS09140 (1829580) 1829580..1830680 - 1101 WP_000063614.1 sodium-potassium/proton antiporter ChaA -
G5S61_RS09145 (1830950) 1830950..1831180 + 231 WP_001146444.1 putative cation transport regulator ChaB -
G5S61_RS09150 (1831338) 1831338..1832033 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 1827320..1828648 1328


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T151362 WP_000170954.1 NZ_CP049606:c1827202-1827095 [Shigella boydii]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T151362 NZ_CP065447:c3322462-3321929 [Klebsiella pneumoniae]
ATGGAGCAGCAACTGACGATTGAGATGATTGCCGATGCGTTCAGCTACGATATCACTGGATTTGATTGCGGCGAGGAAGC
GCTGAATACGTTTTTAAAAGAGCACCTCAAGCGGCAGCACGATGGACAAATCTTAAGGGGTTATGCGCTGGTCTCCGGGG
ATACCGTTCCCAGGTTGCTGGGTTATTACACCTTATCGGGGAGTTGTTTCGAGCGAGGCATGTTGCCGTCTAAAACTCAG
CAAAAGAAAATCCCGTATCAAAATGCGCCAAGCGTAACCCTCGGGCGGCTGGCCATTGATAAATCTGTTCAGGGGCAGGG
CTGGGGAGAGATGTTGGTTGCCCATGTGATGCGAGTGGTGTGGGGAGCGTCTAAAGCCGTTGGCATCTACGGATTGTTTG
TTGAAGCCCTTAATGAGAAAGCTAAAGCATTCTATCTTCGTCTGGGGTTTATACAGCTCGTGGATGAAAATAGTAACTTA
CTGTTTTATCCGACCAAATCGATTGAACAGCTCTTTACTGACGATGAGTCATAA

Antitoxin


Download         Length: 55 bp

>AT151362 NZ_CP049606:1827252-1827306 [Shigella boydii]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References