Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 95894..96148 | Replicon | plasmid pT28R-2 |
| Accession | NZ_CP049355 | ||
| Organism | Escherichia coli strain T28R | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | - |
| Locus tag | G7B60_RS23765 | Protein ID | WP_001351576.1 |
| Coordinates | 95894..96100 (-) | Length | 69 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 96087..96148 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| G7B60_RS23735 | 92481..92828 | - | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| G7B60_RS23740 | 92828..93505 | - | 678 | WP_165899058.1 | IS66-like element accessory protein TnpA | - |
| G7B60_RS23745 | 93722..94579 | - | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
| G7B60_RS23750 | 94572..95054 | - | 483 | WP_001273588.1 | hypothetical protein | - |
| G7B60_RS23755 | 95047..95121 | - | 75 | WP_001442103.1 | RepA leader peptide Tap | - |
| G7B60_RS23760 | 95353..95610 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| G7B60_RS23765 | 95894..96100 | - | 207 | WP_001351576.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 96087..96148 | + | 62 | NuclAT_2 | - | Antitoxin |
| - | 96087..96148 | + | 62 | NuclAT_2 | - | Antitoxin |
| - | 96087..96148 | + | 62 | NuclAT_2 | - | Antitoxin |
| - | 96087..96148 | + | 62 | NuclAT_2 | - | Antitoxin |
| G7B60_RS24610 | 96404..96478 | - | 75 | Protein_103 | endonuclease | - |
| G7B60_RS23770 | 96724..96936 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| G7B60_RS23775 | 97072..97632 | - | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
| G7B60_RS23780 | 97735..98595 | - | 861 | WP_000704514.1 | alpha/beta hydrolase | - |
| G7B60_RS23785 | 98654..99400 | - | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCTX-M-14 / fosA3 / aac(3)-IVa / sul2 / floR / aph(3')-Ia / mph(A) / qacE / aadA2 / dfrA12 / blaTEM-1B / sitABCD | iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA | 1..161057 | 161057 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 69 a.a. Molecular weight: 7826.31 Da Isoelectric Point: 8.8807
>T151306 WP_001351576.1 NZ_CP049355:c96100-95894 [Escherichia coli]
MKYLNTTDCSLFFAERSKFMTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MKYLNTTDCSLFFAERSKFMTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 207 bp
>T151306 NZ_CP065436:666748-666850 [Klebsiella pneumoniae]
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
Antitoxin
Download Length: 62 bp
>AT151306 NZ_CP049355:96087-96148 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|