Detailed information of TA system TA151306

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 95894..96148
• Replicon: plasmid pT28R-2
• Accession: NZ_CP049355
• Organism: Escherichia coli strain T28R

Toxin (Protein)

• Gene name: srnB
• Uniprot ID: -
• Locus tag: G7B60_RS23765
• Protein ID: WP_001351576.1
• Coordinates: 95894..96100 (-)
• Length: 69 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	96087..96148 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
G7B60_RS23735	92481..92828	-	348	WP_000624622.1	IS66 family insertion sequence element accessory protein TnpB	-
G7B60_RS23740	92828..93505	-	678	WP_165899058.1	IS66-like element accessory protein TnpA	-
G7B60_RS23745	93722..94579	-	858	WP_000774297.1	incFII family plasmid replication initiator RepA	-
G7B60_RS23750	94572..95054	-	483	WP_001273588.1	hypothetical protein	-
G7B60_RS23755	95047..95121	-	75	WP_001442103.1	RepA leader peptide Tap	-
G7B60_RS23760	95353..95610	-	258	WP_000083845.1	replication regulatory protein RepA	-
G7B60_RS23765	95894..96100	-	207	WP_001351576.1	type I toxin-antitoxin system Hok family toxin	Toxin
-	96087..96148	+	62	NuclAT_2	-	Antitoxin
-	96087..96148	+	62	NuclAT_2	-	Antitoxin
-	96087..96148	+	62	NuclAT_2	-	Antitoxin
-	96087..96148	+	62	NuclAT_2	-	Antitoxin
G7B60_RS24610	96404..96478	-	75	Protein_103	endonuclease	-
G7B60_RS23770	96724..96936	-	213	WP_001299730.1	ANR family transcriptional regulator	-
G7B60_RS23775	97072..97632	-	561	WP_000139315.1	fertility inhibition protein FinO	-
G7B60_RS23780	97735..98595	-	861	WP_000704514.1	alpha/beta hydrolase	-
G7B60_RS23785	98654..99400	-	747	WP_000205749.1	conjugal transfer pilus acetylase TraX	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	blaCTX-M-14 / fosA3 / aac(3)-IVa / sul2 / floR / aph(3')-Ia / mph(A) / qacE / aadA2 / dfrA12 / blaTEM-1B / sitABCD	iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA	1..161057	161057

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (23-64)

Sequences

Toxin

Protein

• Length: 69 a.a.
• Molecular weight: 7826.31 Da
• Isoelectric Point: 8.8807

>T151306 WP_001351576.1 NZ_CP049355:c96100-95894 [Escherichia coli]
MKYLNTTDCSLFFAERSKFMTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Nucleotide

• Length: 207 bp

>T151306 NZ_CP065436:666748-666850 [Klebsiella pneumoniae]
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT

Antitoxin

Nucleotide

• Length: 62 bp

>AT151306 NZ_CP049355:96087-96148 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Structures

Antitoxin