Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1822506..1822727 Replicon chromosome
Accession NZ_CP049281
Organism Shigella boydii strain 600657

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag G5S55_RS09505 Protein ID WP_000170954.1
Coordinates 1822506..1822613 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1822661..1822727 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
G5S55_RS09480 1818350..1819432 + 1083 WP_000804740.1 peptide chain release factor 1 -
G5S55_RS09485 1819432..1820265 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
G5S55_RS09490 1820262..1820654 + 393 WP_000200378.1 invasion regulator SirB2 -
G5S55_RS09495 1820658..1821467 + 810 WP_001257044.1 invasion regulator SirB1 -
G5S55_RS09500 1821503..1822357 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
G5S55_RS09505 1822506..1822613 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1822661..1822727 + 67 NuclAT_39 - Antitoxin
- 1822661..1822727 + 67 NuclAT_39 - Antitoxin
- 1822661..1822727 + 67 NuclAT_39 - Antitoxin
- 1822661..1822727 + 67 NuclAT_39 - Antitoxin
- 1822661..1822727 + 67 NuclAT_41 - Antitoxin
- 1822661..1822727 + 67 NuclAT_41 - Antitoxin
- 1822661..1822727 + 67 NuclAT_41 - Antitoxin
- 1822661..1822727 + 67 NuclAT_41 - Antitoxin
- 1822661..1822727 + 67 NuclAT_43 - Antitoxin
- 1822661..1822727 + 67 NuclAT_43 - Antitoxin
- 1822661..1822727 + 67 NuclAT_43 - Antitoxin
- 1822661..1822727 + 67 NuclAT_43 - Antitoxin
G5S55_RS09510 1823041..1823148 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1823201..1823262 + 62 NuclAT_27 - -
- 1823201..1823262 + 62 NuclAT_27 - -
- 1823201..1823262 + 62 NuclAT_27 - -
- 1823201..1823262 + 62 NuclAT_27 - -
- 1823201..1823262 + 62 NuclAT_29 - -
- 1823201..1823262 + 62 NuclAT_29 - -
- 1823201..1823262 + 62 NuclAT_29 - -
- 1823201..1823262 + 62 NuclAT_29 - -
- 1823201..1823262 + 62 NuclAT_31 - -
- 1823201..1823262 + 62 NuclAT_31 - -
- 1823201..1823262 + 62 NuclAT_31 - -
- 1823201..1823262 + 62 NuclAT_31 - -
- 1823201..1823262 + 62 NuclAT_33 - -
- 1823201..1823262 + 62 NuclAT_33 - -
- 1823201..1823262 + 62 NuclAT_33 - -
- 1823201..1823262 + 62 NuclAT_33 - -
- 1823201..1823262 + 62 NuclAT_35 - -
- 1823201..1823262 + 62 NuclAT_35 - -
- 1823201..1823262 + 62 NuclAT_35 - -
- 1823201..1823262 + 62 NuclAT_35 - -
- 1823201..1823262 + 62 NuclAT_37 - -
- 1823201..1823262 + 62 NuclAT_37 - -
- 1823201..1823262 + 62 NuclAT_37 - -
- 1823201..1823262 + 62 NuclAT_37 - -
- 1823201..1823263 + 63 NuclAT_38 - -
- 1823201..1823263 + 63 NuclAT_38 - -
- 1823201..1823263 + 63 NuclAT_38 - -
- 1823201..1823263 + 63 NuclAT_38 - -
- 1823201..1823263 + 63 NuclAT_40 - -
- 1823201..1823263 + 63 NuclAT_40 - -
- 1823201..1823263 + 63 NuclAT_40 - -
- 1823201..1823263 + 63 NuclAT_40 - -
- 1823201..1823263 + 63 NuclAT_42 - -
- 1823201..1823263 + 63 NuclAT_42 - -
- 1823201..1823263 + 63 NuclAT_42 - -
- 1823201..1823263 + 63 NuclAT_42 - -
- 1823201..1823264 + 64 NuclAT_15 - -
- 1823201..1823264 + 64 NuclAT_15 - -
- 1823201..1823264 + 64 NuclAT_15 - -
- 1823201..1823264 + 64 NuclAT_15 - -
- 1823201..1823264 + 64 NuclAT_17 - -
- 1823201..1823264 + 64 NuclAT_17 - -
- 1823201..1823264 + 64 NuclAT_17 - -
- 1823201..1823264 + 64 NuclAT_17 - -
- 1823201..1823264 + 64 NuclAT_19 - -
- 1823201..1823264 + 64 NuclAT_19 - -
- 1823201..1823264 + 64 NuclAT_19 - -
- 1823201..1823264 + 64 NuclAT_19 - -
- 1823201..1823264 + 64 NuclAT_21 - -
- 1823201..1823264 + 64 NuclAT_21 - -
- 1823201..1823264 + 64 NuclAT_21 - -
- 1823201..1823264 + 64 NuclAT_21 - -
- 1823201..1823264 + 64 NuclAT_23 - -
- 1823201..1823264 + 64 NuclAT_23 - -
- 1823201..1823264 + 64 NuclAT_23 - -
- 1823201..1823264 + 64 NuclAT_23 - -
- 1823201..1823264 + 64 NuclAT_25 - -
- 1823201..1823264 + 64 NuclAT_25 - -
- 1823201..1823264 + 64 NuclAT_25 - -
- 1823201..1823264 + 64 NuclAT_25 - -
G5S55_RS09515 1823577..1823684 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1823732..1823797 + 66 NuclAT_26 - -
- 1823732..1823797 + 66 NuclAT_26 - -
- 1823732..1823797 + 66 NuclAT_26 - -
- 1823732..1823797 + 66 NuclAT_26 - -
- 1823732..1823797 + 66 NuclAT_28 - -
- 1823732..1823797 + 66 NuclAT_28 - -
- 1823732..1823797 + 66 NuclAT_28 - -
- 1823732..1823797 + 66 NuclAT_28 - -
- 1823732..1823797 + 66 NuclAT_30 - -
- 1823732..1823797 + 66 NuclAT_30 - -
- 1823732..1823797 + 66 NuclAT_30 - -
- 1823732..1823797 + 66 NuclAT_30 - -
- 1823732..1823797 + 66 NuclAT_32 - -
- 1823732..1823797 + 66 NuclAT_32 - -
- 1823732..1823797 + 66 NuclAT_32 - -
- 1823732..1823797 + 66 NuclAT_32 - -
- 1823732..1823797 + 66 NuclAT_34 - -
- 1823732..1823797 + 66 NuclAT_34 - -
- 1823732..1823797 + 66 NuclAT_34 - -
- 1823732..1823797 + 66 NuclAT_34 - -
- 1823732..1823797 + 66 NuclAT_36 - -
- 1823732..1823797 + 66 NuclAT_36 - -
- 1823732..1823797 + 66 NuclAT_36 - -
- 1823732..1823797 + 66 NuclAT_36 - -
- 1823732..1823799 + 68 NuclAT_14 - -
- 1823732..1823799 + 68 NuclAT_14 - -
- 1823732..1823799 + 68 NuclAT_14 - -
- 1823732..1823799 + 68 NuclAT_14 - -
- 1823732..1823799 + 68 NuclAT_16 - -
- 1823732..1823799 + 68 NuclAT_16 - -
- 1823732..1823799 + 68 NuclAT_16 - -
- 1823732..1823799 + 68 NuclAT_16 - -
- 1823732..1823799 + 68 NuclAT_18 - -
- 1823732..1823799 + 68 NuclAT_18 - -
- 1823732..1823799 + 68 NuclAT_18 - -
- 1823732..1823799 + 68 NuclAT_18 - -
- 1823732..1823799 + 68 NuclAT_20 - -
- 1823732..1823799 + 68 NuclAT_20 - -
- 1823732..1823799 + 68 NuclAT_20 - -
- 1823732..1823799 + 68 NuclAT_20 - -
- 1823732..1823799 + 68 NuclAT_22 - -
- 1823732..1823799 + 68 NuclAT_22 - -
- 1823732..1823799 + 68 NuclAT_22 - -
- 1823732..1823799 + 68 NuclAT_22 - -
- 1823732..1823799 + 68 NuclAT_24 - -
- 1823732..1823799 + 68 NuclAT_24 - -
- 1823732..1823799 + 68 NuclAT_24 - -
- 1823732..1823799 + 68 NuclAT_24 - -
G5S55_RS09520 1824089..1825189 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
G5S55_RS09525 1825459..1825689 + 231 WP_001146442.1 putative cation transport regulator ChaB -
G5S55_RS09530 1825847..1826542 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
G5S55_RS09535 1826586..1826939 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T151137 WP_000170954.1 NZ_CP049281:c1822613-1822506 [Shigella boydii]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T151137 NZ_CP065343:c4490078-4489668 [Klebsiella pneumoniae]
GTGGTCCTGTGGCAATCTGATCTCCGTATCTCCTGGCGCGCGCAGTGGTTTTCCCTGCTGCTTCACGGCGTGGTGGCGGC
CCTGGTGCTGTTGGTTCCCTGGCCGCTGAGCTATACCCCGATCTGGCTGCTGCTGCTGTCGCTGGTGGTCTTCGACTGCG
TGCGCAGCCAGCGGCGGATCCATGCCCGTCGCGGGGAGATAAAACTGCTCACCGATTCCCGTCTTCGCTGGCAAAACGCC
GAATGGGAAATCCTCGGGACGCCGTGGGTTATCAATAGCGGTATGCTGCTGCGTTTGCGCCATGTCGATACCCGGCGCGG
ACAGCATCTTTGGCTGGCGGCGGACAGCATGGACGCCGGAGAGTGGCGCGATCTGCGCCGGCTGGTGCTGCAAAAACCGG
CGCAGGAGTAA

Antitoxin


Download         Length: 67 bp

>AT151137 NZ_CP049281:1822661-1822727 [Shigella boydii]
GTTCTGGTTCAAGATTAGCCCCCGTTCTATTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References