Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 1822506..1822727 | Replicon | chromosome |
| Accession | NZ_CP049281 | ||
| Organism | Shigella boydii strain 600657 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1PGT3 |
| Locus tag | G5S55_RS09505 | Protein ID | WP_000170954.1 |
| Coordinates | 1822506..1822613 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 1822661..1822727 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| G5S55_RS09480 | 1818350..1819432 | + | 1083 | WP_000804740.1 | peptide chain release factor 1 | - |
| G5S55_RS09485 | 1819432..1820265 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| G5S55_RS09490 | 1820262..1820654 | + | 393 | WP_000200378.1 | invasion regulator SirB2 | - |
| G5S55_RS09495 | 1820658..1821467 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| G5S55_RS09500 | 1821503..1822357 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| G5S55_RS09505 | 1822506..1822613 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 1822661..1822727 | + | 67 | NuclAT_39 | - | Antitoxin |
| - | 1822661..1822727 | + | 67 | NuclAT_39 | - | Antitoxin |
| - | 1822661..1822727 | + | 67 | NuclAT_39 | - | Antitoxin |
| - | 1822661..1822727 | + | 67 | NuclAT_39 | - | Antitoxin |
| - | 1822661..1822727 | + | 67 | NuclAT_41 | - | Antitoxin |
| - | 1822661..1822727 | + | 67 | NuclAT_41 | - | Antitoxin |
| - | 1822661..1822727 | + | 67 | NuclAT_41 | - | Antitoxin |
| - | 1822661..1822727 | + | 67 | NuclAT_41 | - | Antitoxin |
| - | 1822661..1822727 | + | 67 | NuclAT_43 | - | Antitoxin |
| - | 1822661..1822727 | + | 67 | NuclAT_43 | - | Antitoxin |
| - | 1822661..1822727 | + | 67 | NuclAT_43 | - | Antitoxin |
| - | 1822661..1822727 | + | 67 | NuclAT_43 | - | Antitoxin |
| G5S55_RS09510 | 1823041..1823148 | - | 108 | WP_000170926.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 1823201..1823262 | + | 62 | NuclAT_27 | - | - |
| - | 1823201..1823262 | + | 62 | NuclAT_27 | - | - |
| - | 1823201..1823262 | + | 62 | NuclAT_27 | - | - |
| - | 1823201..1823262 | + | 62 | NuclAT_27 | - | - |
| - | 1823201..1823262 | + | 62 | NuclAT_29 | - | - |
| - | 1823201..1823262 | + | 62 | NuclAT_29 | - | - |
| - | 1823201..1823262 | + | 62 | NuclAT_29 | - | - |
| - | 1823201..1823262 | + | 62 | NuclAT_29 | - | - |
| - | 1823201..1823262 | + | 62 | NuclAT_31 | - | - |
| - | 1823201..1823262 | + | 62 | NuclAT_31 | - | - |
| - | 1823201..1823262 | + | 62 | NuclAT_31 | - | - |
| - | 1823201..1823262 | + | 62 | NuclAT_31 | - | - |
| - | 1823201..1823262 | + | 62 | NuclAT_33 | - | - |
| - | 1823201..1823262 | + | 62 | NuclAT_33 | - | - |
| - | 1823201..1823262 | + | 62 | NuclAT_33 | - | - |
| - | 1823201..1823262 | + | 62 | NuclAT_33 | - | - |
| - | 1823201..1823262 | + | 62 | NuclAT_35 | - | - |
| - | 1823201..1823262 | + | 62 | NuclAT_35 | - | - |
| - | 1823201..1823262 | + | 62 | NuclAT_35 | - | - |
| - | 1823201..1823262 | + | 62 | NuclAT_35 | - | - |
| - | 1823201..1823262 | + | 62 | NuclAT_37 | - | - |
| - | 1823201..1823262 | + | 62 | NuclAT_37 | - | - |
| - | 1823201..1823262 | + | 62 | NuclAT_37 | - | - |
| - | 1823201..1823262 | + | 62 | NuclAT_37 | - | - |
| - | 1823201..1823263 | + | 63 | NuclAT_38 | - | - |
| - | 1823201..1823263 | + | 63 | NuclAT_38 | - | - |
| - | 1823201..1823263 | + | 63 | NuclAT_38 | - | - |
| - | 1823201..1823263 | + | 63 | NuclAT_38 | - | - |
| - | 1823201..1823263 | + | 63 | NuclAT_40 | - | - |
| - | 1823201..1823263 | + | 63 | NuclAT_40 | - | - |
| - | 1823201..1823263 | + | 63 | NuclAT_40 | - | - |
| - | 1823201..1823263 | + | 63 | NuclAT_40 | - | - |
| - | 1823201..1823263 | + | 63 | NuclAT_42 | - | - |
| - | 1823201..1823263 | + | 63 | NuclAT_42 | - | - |
| - | 1823201..1823263 | + | 63 | NuclAT_42 | - | - |
| - | 1823201..1823263 | + | 63 | NuclAT_42 | - | - |
| - | 1823201..1823264 | + | 64 | NuclAT_15 | - | - |
| - | 1823201..1823264 | + | 64 | NuclAT_15 | - | - |
| - | 1823201..1823264 | + | 64 | NuclAT_15 | - | - |
| - | 1823201..1823264 | + | 64 | NuclAT_15 | - | - |
| - | 1823201..1823264 | + | 64 | NuclAT_17 | - | - |
| - | 1823201..1823264 | + | 64 | NuclAT_17 | - | - |
| - | 1823201..1823264 | + | 64 | NuclAT_17 | - | - |
| - | 1823201..1823264 | + | 64 | NuclAT_17 | - | - |
| - | 1823201..1823264 | + | 64 | NuclAT_19 | - | - |
| - | 1823201..1823264 | + | 64 | NuclAT_19 | - | - |
| - | 1823201..1823264 | + | 64 | NuclAT_19 | - | - |
| - | 1823201..1823264 | + | 64 | NuclAT_19 | - | - |
| - | 1823201..1823264 | + | 64 | NuclAT_21 | - | - |
| - | 1823201..1823264 | + | 64 | NuclAT_21 | - | - |
| - | 1823201..1823264 | + | 64 | NuclAT_21 | - | - |
| - | 1823201..1823264 | + | 64 | NuclAT_21 | - | - |
| - | 1823201..1823264 | + | 64 | NuclAT_23 | - | - |
| - | 1823201..1823264 | + | 64 | NuclAT_23 | - | - |
| - | 1823201..1823264 | + | 64 | NuclAT_23 | - | - |
| - | 1823201..1823264 | + | 64 | NuclAT_23 | - | - |
| - | 1823201..1823264 | + | 64 | NuclAT_25 | - | - |
| - | 1823201..1823264 | + | 64 | NuclAT_25 | - | - |
| - | 1823201..1823264 | + | 64 | NuclAT_25 | - | - |
| - | 1823201..1823264 | + | 64 | NuclAT_25 | - | - |
| G5S55_RS09515 | 1823577..1823684 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 1823732..1823797 | + | 66 | NuclAT_26 | - | - |
| - | 1823732..1823797 | + | 66 | NuclAT_26 | - | - |
| - | 1823732..1823797 | + | 66 | NuclAT_26 | - | - |
| - | 1823732..1823797 | + | 66 | NuclAT_26 | - | - |
| - | 1823732..1823797 | + | 66 | NuclAT_28 | - | - |
| - | 1823732..1823797 | + | 66 | NuclAT_28 | - | - |
| - | 1823732..1823797 | + | 66 | NuclAT_28 | - | - |
| - | 1823732..1823797 | + | 66 | NuclAT_28 | - | - |
| - | 1823732..1823797 | + | 66 | NuclAT_30 | - | - |
| - | 1823732..1823797 | + | 66 | NuclAT_30 | - | - |
| - | 1823732..1823797 | + | 66 | NuclAT_30 | - | - |
| - | 1823732..1823797 | + | 66 | NuclAT_30 | - | - |
| - | 1823732..1823797 | + | 66 | NuclAT_32 | - | - |
| - | 1823732..1823797 | + | 66 | NuclAT_32 | - | - |
| - | 1823732..1823797 | + | 66 | NuclAT_32 | - | - |
| - | 1823732..1823797 | + | 66 | NuclAT_32 | - | - |
| - | 1823732..1823797 | + | 66 | NuclAT_34 | - | - |
| - | 1823732..1823797 | + | 66 | NuclAT_34 | - | - |
| - | 1823732..1823797 | + | 66 | NuclAT_34 | - | - |
| - | 1823732..1823797 | + | 66 | NuclAT_34 | - | - |
| - | 1823732..1823797 | + | 66 | NuclAT_36 | - | - |
| - | 1823732..1823797 | + | 66 | NuclAT_36 | - | - |
| - | 1823732..1823797 | + | 66 | NuclAT_36 | - | - |
| - | 1823732..1823797 | + | 66 | NuclAT_36 | - | - |
| - | 1823732..1823799 | + | 68 | NuclAT_14 | - | - |
| - | 1823732..1823799 | + | 68 | NuclAT_14 | - | - |
| - | 1823732..1823799 | + | 68 | NuclAT_14 | - | - |
| - | 1823732..1823799 | + | 68 | NuclAT_14 | - | - |
| - | 1823732..1823799 | + | 68 | NuclAT_16 | - | - |
| - | 1823732..1823799 | + | 68 | NuclAT_16 | - | - |
| - | 1823732..1823799 | + | 68 | NuclAT_16 | - | - |
| - | 1823732..1823799 | + | 68 | NuclAT_16 | - | - |
| - | 1823732..1823799 | + | 68 | NuclAT_18 | - | - |
| - | 1823732..1823799 | + | 68 | NuclAT_18 | - | - |
| - | 1823732..1823799 | + | 68 | NuclAT_18 | - | - |
| - | 1823732..1823799 | + | 68 | NuclAT_18 | - | - |
| - | 1823732..1823799 | + | 68 | NuclAT_20 | - | - |
| - | 1823732..1823799 | + | 68 | NuclAT_20 | - | - |
| - | 1823732..1823799 | + | 68 | NuclAT_20 | - | - |
| - | 1823732..1823799 | + | 68 | NuclAT_20 | - | - |
| - | 1823732..1823799 | + | 68 | NuclAT_22 | - | - |
| - | 1823732..1823799 | + | 68 | NuclAT_22 | - | - |
| - | 1823732..1823799 | + | 68 | NuclAT_22 | - | - |
| - | 1823732..1823799 | + | 68 | NuclAT_22 | - | - |
| - | 1823732..1823799 | + | 68 | NuclAT_24 | - | - |
| - | 1823732..1823799 | + | 68 | NuclAT_24 | - | - |
| - | 1823732..1823799 | + | 68 | NuclAT_24 | - | - |
| - | 1823732..1823799 | + | 68 | NuclAT_24 | - | - |
| G5S55_RS09520 | 1824089..1825189 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| G5S55_RS09525 | 1825459..1825689 | + | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
| G5S55_RS09530 | 1825847..1826542 | + | 696 | WP_001297117.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| G5S55_RS09535 | 1826586..1826939 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3983.80 Da Isoelectric Point: 11.4779
>T151137 WP_000170954.1 NZ_CP049281:c1822613-1822506 [Shigella boydii]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T151137 NZ_CP065343:c4490078-4489668 [Klebsiella pneumoniae]
GTGGTCCTGTGGCAATCTGATCTCCGTATCTCCTGGCGCGCGCAGTGGTTTTCCCTGCTGCTTCACGGCGTGGTGGCGGC
CCTGGTGCTGTTGGTTCCCTGGCCGCTGAGCTATACCCCGATCTGGCTGCTGCTGCTGTCGCTGGTGGTCTTCGACTGCG
TGCGCAGCCAGCGGCGGATCCATGCCCGTCGCGGGGAGATAAAACTGCTCACCGATTCCCGTCTTCGCTGGCAAAACGCC
GAATGGGAAATCCTCGGGACGCCGTGGGTTATCAATAGCGGTATGCTGCTGCGTTTGCGCCATGTCGATACCCGGCGCGG
ACAGCATCTTTGGCTGGCGGCGGACAGCATGGACGCCGGAGAGTGGCGCGATCTGCGCCGGCTGGTGCTGCAAAAACCGG
CGCAGGAGTAA
GTGGTCCTGTGGCAATCTGATCTCCGTATCTCCTGGCGCGCGCAGTGGTTTTCCCTGCTGCTTCACGGCGTGGTGGCGGC
CCTGGTGCTGTTGGTTCCCTGGCCGCTGAGCTATACCCCGATCTGGCTGCTGCTGCTGTCGCTGGTGGTCTTCGACTGCG
TGCGCAGCCAGCGGCGGATCCATGCCCGTCGCGGGGAGATAAAACTGCTCACCGATTCCCGTCTTCGCTGGCAAAACGCC
GAATGGGAAATCCTCGGGACGCCGTGGGTTATCAATAGCGGTATGCTGCTGCGTTTGCGCCATGTCGATACCCGGCGCGG
ACAGCATCTTTGGCTGGCGGCGGACAGCATGGACGCCGGAGAGTGGCGCGATCTGCGCCGGCTGGTGCTGCAAAAACCGG
CGCAGGAGTAA
Antitoxin
Download Length: 67 bp
>AT151137 NZ_CP049281:1822661-1822727 [Shigella boydii]
GTTCTGGTTCAAGATTAGCCCCCGTTCTATTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTATTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|