Detailed information of TA system TA150997

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/Ldr(toxin)
• Location: 2943579..2943799
• Replicon: chromosome
• Accession: NZ_CP049201
• Organism: Escherichia coli strain PapRG-04-4

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: J7R083
• Locus tag: G6Z99_RS14415
• Protein ID: WP_000170963.1
• Coordinates: 2943692..2943799 (+)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	-
Coordinates	2943579..2943645 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
G6Z99_RS14390	2938858..2940252	-	1395	WP_164475811.1	inverse autotransporter invasin YchO	-
G6Z99_RS14395	2940437..2940790	+	354	WP_001169669.1	DsrE/F sulfur relay family protein YchN	-
G6Z99_RS14400	2940834..2941529	-	696	WP_001336325.1	glutathione-specific gamma-glutamylcyclotransferase	-
G6Z99_RS14405	2941687..2941917	-	231	WP_001146444.1	putative cation transport regulator ChaB	-
G6Z99_RS14410	2942187..2943287	+	1101	WP_001301956.1	sodium-potassium/proton antiporter ChaA	-
-	2943579..2943645	-	67	-	-	Antitoxin
G6Z99_RS14415	2943692..2943799	+	108	WP_000170963.1	small toxic polypeptide LdrB	Toxin
-	2944112..2944175	-	64	NuclAT_30	-	-
-	2944112..2944175	-	64	NuclAT_30	-	-
-	2944112..2944175	-	64	NuclAT_30	-	-
-	2944112..2944175	-	64	NuclAT_30	-	-
-	2944112..2944175	-	64	NuclAT_32	-	-
-	2944112..2944175	-	64	NuclAT_32	-	-
-	2944112..2944175	-	64	NuclAT_32	-	-
-	2944112..2944175	-	64	NuclAT_32	-	-
-	2944112..2944175	-	64	NuclAT_34	-	-
-	2944112..2944175	-	64	NuclAT_34	-	-
-	2944112..2944175	-	64	NuclAT_34	-	-
-	2944112..2944175	-	64	NuclAT_34	-	-
-	2944112..2944175	-	64	NuclAT_36	-	-
-	2944112..2944175	-	64	NuclAT_36	-	-
-	2944112..2944175	-	64	NuclAT_36	-	-
-	2944112..2944175	-	64	NuclAT_36	-	-
-	2944112..2944175	-	64	NuclAT_38	-	-
-	2944112..2944175	-	64	NuclAT_38	-	-
-	2944112..2944175	-	64	NuclAT_38	-	-
-	2944112..2944175	-	64	NuclAT_38	-	-
-	2944112..2944175	-	64	NuclAT_40	-	-
-	2944112..2944175	-	64	NuclAT_40	-	-
-	2944112..2944175	-	64	NuclAT_40	-	-
-	2944112..2944175	-	64	NuclAT_40	-	-
-	2944114..2944175	-	62	NuclAT_16	-	-
-	2944114..2944175	-	62	NuclAT_16	-	-
-	2944114..2944175	-	62	NuclAT_16	-	-
-	2944114..2944175	-	62	NuclAT_16	-	-
-	2944114..2944175	-	62	NuclAT_18	-	-
-	2944114..2944175	-	62	NuclAT_18	-	-
-	2944114..2944175	-	62	NuclAT_18	-	-
-	2944114..2944175	-	62	NuclAT_18	-	-
-	2944114..2944175	-	62	NuclAT_20	-	-
-	2944114..2944175	-	62	NuclAT_20	-	-
-	2944114..2944175	-	62	NuclAT_20	-	-
-	2944114..2944175	-	62	NuclAT_20	-	-
-	2944114..2944175	-	62	NuclAT_22	-	-
-	2944114..2944175	-	62	NuclAT_22	-	-
-	2944114..2944175	-	62	NuclAT_22	-	-
-	2944114..2944175	-	62	NuclAT_22	-	-
-	2944114..2944175	-	62	NuclAT_24	-	-
-	2944114..2944175	-	62	NuclAT_24	-	-
-	2944114..2944175	-	62	NuclAT_24	-	-
-	2944114..2944175	-	62	NuclAT_24	-	-
-	2944114..2944175	-	62	NuclAT_26	-	-
-	2944114..2944175	-	62	NuclAT_26	-	-
-	2944114..2944175	-	62	NuclAT_26	-	-
-	2944114..2944175	-	62	NuclAT_26	-	-
G6Z99_RS14420	2944228..2944335	+	108	WP_000170954.1	type I toxin-antitoxin system toxin Ldr family protein	-
G6Z99_RS14425	2944484..2945338	-	855	WP_000811065.1	3-deoxy-8-phosphooctulonate synthase	-
G6Z99_RS14430	2945374..2946183	-	810	WP_001257044.1	invasion regulator SirB1	-
G6Z99_RS14435	2946187..2946579	-	393	WP_000200378.1	invasion regulator SirB2	-
G6Z99_RS14440	2946576..2947409	-	834	WP_000456448.1	peptide chain release factor N(5)-glutamine methyltransferase	-
G6Z99_RS14445	2947409..2948491	-	1083	WP_047669131.1	peptide chain release factor 1	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 3971.74 Da
• Isoelectric Point: 11.4779

>T150997 WP_000170963.1 NZ_CP049201:2943692-2943799 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Nucleotide

• Length: 108 bp

>T150997 NZ_CP065172:324378-324746 [Klebsiella pneumoniae]
ATGACGCTGCAGATTATCTCAGCGGAAGAGATAATACAGTTTCACGACAGGCTGCTCCGCGTCACGCCTGGCGTTGCCGG
TATGCCCGATCCGGGGCGTGCCGAAGCGATAATGTATAGGGTGCTAAACAAAATTGAATATGAAGGTGTGACAGACGTGT
GGCGACTCGCTGCGATGCATCTGCTGGCGATTTCTCGCGGTCATATATTTAATGATGGTAATAAGCGTACGGCACTGTTT
ATCACTCTGCTTTTTTTAAAGCGAAATGGAATTATATTGCCGGCGAATCCAGACTTCGTCGGCATGACCGTCGAGGCGGC
AGCAGGGCAACTTACCCTGGAACAGATTGTCGCGCGCTTGCGCGGATGA

Antitoxin

Nucleotide

• Length: 67 bp

>AT150997 NZ_CP049201:c2943645-2943579 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Structures

Antitoxin