Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 52790..53054 | Replicon | plasmid p1205-3131 |
Accession | NZ_CP049178 | ||
Organism | Shigella sonnei strain 1205.3131 |
Toxin (Protein)
Gene name | pndA | Uniprot ID | U9Z417 |
Locus tag | G6O63_RS25015 | Protein ID | WP_001387489.1 |
Coordinates | 52790..52942 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | pndB | ||
Locus tag | - | ||
Coordinates | 52992..53054 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
G6O63_RS24985 (48091) | 48091..50259 | + | 2169 | WP_001774191.1 | DotA/TraY family protein | - |
G6O63_RS24990 (50333) | 50333..50983 | + | 651 | WP_001178506.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
G6O63_RS24995 (51055) | 51055..51264 | - | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
G6O63_RS25000 (51630) | 51630..51806 | + | 177 | WP_001054898.1 | hypothetical protein | - |
G6O63_RS25315 (51871) | 51871..51966 | - | 96 | WP_000609148.1 | DinQ-like type I toxin DqlB | - |
G6O63_RS25010 (52467) | 52467..52718 | + | 252 | WP_001291964.1 | hypothetical protein | - |
G6O63_RS25015 (52790) | 52790..52942 | - | 153 | WP_001387489.1 | Hok/Gef family protein | Toxin |
- (52992) | 52992..53054 | + | 63 | NuclAT_0 | - | Antitoxin |
- (52992) | 52992..53054 | + | 63 | NuclAT_0 | - | Antitoxin |
- (52992) | 52992..53054 | + | 63 | NuclAT_0 | - | Antitoxin |
- (52992) | 52992..53054 | + | 63 | NuclAT_0 | - | Antitoxin |
G6O63_RS25020 (53569) | 53569..54348 | + | 780 | WP_275450201.1 | protein FinQ | - |
G6O63_RS25025 (54655) | 54655..55863 | + | 1209 | WP_107372241.1 | IncI1-type conjugal transfer protein TrbA | - |
G6O63_RS25030 (55882) | 55882..56952 | + | 1071 | WP_000151590.1 | IncI1-type conjugal transfer protein TrbB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaCTX-M-3 | - | 1..86039 | 86039 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5761.10 Da Isoelectric Point: 8.7948
>T150809 WP_001387489.1 NZ_CP049178:c52942-52790 [Shigella sonnei]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T150809 NZ_CP065036:2875704-2875907 [Pectobacterium parmentieri]
ATGAAAAAAATCGACTATTTGATGCGTTTGCGTAAATGCACAACGATTGACACTCTCGAACGCGTTATTGAAAAAAACAA
GTATGAACTCTCCAATGATGAACTGGAGATGTTCTTTTCTGCAGCCGATCATCGCCTGGCAGAGTTGACGATGAACAAAC
TCTACGACAAAGTTCCTACCGCAGTATGGCGATACGTCCGTTAA
ATGAAAAAAATCGACTATTTGATGCGTTTGCGTAAATGCACAACGATTGACACTCTCGAACGCGTTATTGAAAAAAACAA
GTATGAACTCTCCAATGATGAACTGGAGATGTTCTTTTCTGCAGCCGATCATCGCCTGGCAGAGTTGACGATGAACAAAC
TCTACGACAAAGTTCCTACCGCAGTATGGCGATACGTCCGTTAA
Antitoxin
Download Length: 63 bp
>AT150809 NZ_CP049178:52992-53054 [Shigella sonnei]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|