Detailed information of TA system TA150585

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 95930..96184
• Replicon: plasmid pEC931_1
• Accession: NZ_CP049119
• Organism: Escherichia coli strain EC931

Toxin (Protein)

• Gene name: srnB
• Uniprot ID: -
• Locus tag: G6G93_RS23655
• Protein ID: WP_001351576.1
• Coordinates: 95930..96136 (-)
• Length: 69 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	96123..96184 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
G6G93_RS23620	90967..92580	-	1614	WP_000080193.1	IS66-like element ISEc23 family transposase	-
G6G93_RS23625	92611..92961	-	351	WP_000624722.1	IS66 family insertion sequence element accessory protein TnpB	-
G6G93_RS23630	92958..93383	-	426	WP_000422741.1	IS66 family insertion sequence hypothetical protein	-
G6G93_RS23635	93758..94615	-	858	WP_000774297.1	incFII family plasmid replication initiator RepA	-
G6G93_RS23640	94608..95090	-	483	WP_001273588.1	hypothetical protein	-
G6G93_RS23645	95083..95157	-	75	WP_001442103.1	RepA leader peptide Tap	-
G6G93_RS23650	95389..95646	-	258	WP_000083845.1	replication regulatory protein RepA	-
G6G93_RS23655	95930..96136	-	207	WP_001351576.1	type I toxin-antitoxin system Hok family toxin	Toxin
-	96123..96184	+	62	NuclAT_1	-	Antitoxin
-	96123..96184	+	62	NuclAT_1	-	Antitoxin
-	96123..96184	+	62	NuclAT_1	-	Antitoxin
-	96123..96184	+	62	NuclAT_1	-	Antitoxin
G6G93_RS23660	96440..96514	-	75	Protein_94	endonuclease	-
G6G93_RS23665	96760..96972	-	213	WP_001299730.1	ANR family transcriptional regulator	-
G6G93_RS23670	97108..97668	-	561	WP_000139315.1	fertility inhibition protein FinO	-
G6G93_RS23675	97771..98631	-	861	WP_000704514.1	alpha/beta hydrolase	-
G6G93_RS23680	98690..99436	-	747	WP_000205749.1	conjugal transfer pilus acetylase TraX	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	blaTEM-1B / tet(B) / catA1 / sul2 / aph(3'')-Ib / aph(6)-Id / aac(3)-IId / sitABCD	iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA	1..159690	159690

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (23-64)

Sequences

Toxin

Protein

• Length: 69 a.a.
• Molecular weight: 7826.31 Da
• Isoelectric Point: 8.8807

>T150585 WP_001351576.1 NZ_CP049119:c96136-95930 [Escherichia coli]
MKYLNTTDCSLFFAERSKFMTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Nucleotide

• Length: 207 bp

>T150585 NZ_CP064825:c3966705-3966598 [Escherichia coli UTI89]
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA

Antitoxin

Nucleotide

• Length: 62 bp

>AT150585 NZ_CP049119:96123-96184 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Structures

Antitoxin