Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 19926..20159 | Replicon | plasmid p11A_p2 |
Accession | NZ_CP049079 | ||
Organism | Escherichia coli strain p11A |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | G6P89_RS26555 | Protein ID | WP_001312861.1 |
Coordinates | 20001..20159 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | srnC | ||
Locus tag | - | ||
Coordinates | 19926..19957 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
G6P89_RS26520 | 16047..16544 | + | 498 | WP_042039995.1 | single-stranded DNA-binding protein | - |
G6P89_RS26525 | 16612..16845 | + | 234 | WP_000005990.1 | DUF905 family protein | - |
G6P89_RS26530 | 16873..17070 | + | 198 | Protein_21 | hypothetical protein | - |
G6P89_RS26535 | 17125..17559 | + | 435 | WP_000845937.1 | conjugation system SOS inhibitor PsiB | - |
G6P89_RS26540 | 17556..18275 | + | 720 | WP_001276238.1 | plasmid SOS inhibition protein A | - |
G6P89_RS26545 | 18287..18475 | - | 189 | WP_001299721.1 | hypothetical protein | - |
- | 18287..18484 | + | 198 | NuclAT_0 | - | - |
- | 18287..18484 | + | 198 | NuclAT_0 | - | - |
- | 18287..18484 | + | 198 | NuclAT_0 | - | - |
- | 18287..18484 | + | 198 | NuclAT_0 | - | - |
G6P89_RS26550 | 18532..19901 | + | 1370 | WP_085947770.1 | IS3-like element IS150 family transposase | - |
- | 19926..19957 | + | 32 | NuclAT_1 | - | Antitoxin |
- | 19926..19957 | + | 32 | NuclAT_1 | - | Antitoxin |
- | 19926..19957 | + | 32 | NuclAT_1 | - | Antitoxin |
- | 19926..19957 | + | 32 | NuclAT_1 | - | Antitoxin |
G6P89_RS26555 | 20001..20159 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
G6P89_RS26560 | 21080..21367 | + | 288 | WP_000107535.1 | hypothetical protein | - |
G6P89_RS26565 | 21485..22306 | + | 822 | WP_001234426.1 | DUF945 domain-containing protein | - |
G6P89_RS26570 | 22603..23205 | - | 603 | WP_013362798.1 | transglycosylase SLT domain-containing protein | - |
G6P89_RS26575 | 23526..23909 | + | 384 | WP_001151524.1 | relaxosome protein TraM | - |
G6P89_RS26580 | 24096..24785 | + | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | tet(A) / mph(A) / sul1 / qacE / aadA5 / aac(3)-IIa / blaOXA-1 / aac(6')-Ib-cr / blaCTX-M-15 | senB | 1..180962 | 180962 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T150378 WP_001312861.1 NZ_CP049079:20001-20159 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T150378 NZ_CP064679:c3227814-3227500 [Escherichia coli K-12]
ATGCACCTGATAACTCAAAAAGCATTGAAAGATGCTGCGGAAAAATACCCGCAACATAAAACGGAGTTGGTGGCTCTGGG
GAACACGATTGCTAAGGGATATTTCAAAAAACCTGAGTCATTAAAAGCAGTATTCCCATCTCTGGATAACTTCAAATATC
TGGATAAGCATTATGTTTTCAATGTTGGGGGCAATGAATTACGTGTTGTAGCAATGGTCTTTTTTGAATCGCAAAAGTGC
TACATACGTGAAGTTATGACGCATAAAGAATACGATTTCTTTACCGCTGTTCATCGTACTAAGGGGAAAAAATGA
ATGCACCTGATAACTCAAAAAGCATTGAAAGATGCTGCGGAAAAATACCCGCAACATAAAACGGAGTTGGTGGCTCTGGG
GAACACGATTGCTAAGGGATATTTCAAAAAACCTGAGTCATTAAAAGCAGTATTCCCATCTCTGGATAACTTCAAATATC
TGGATAAGCATTATGTTTTCAATGTTGGGGGCAATGAATTACGTGTTGTAGCAATGGTCTTTTTTGAATCGCAAAAGTGC
TACATACGTGAAGTTATGACGCATAAAGAATACGATTTCTTTACCGCTGTTCATCGTACTAAGGGGAAAAAATGA
Antitoxin
Download Length: 32 bp
>AT150378 NZ_CP049079:19926-19957 [Escherichia coli]
CACCACGAGGCATCCCTATGTCTAGTCCACAT
CACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|