Detailed information of TA system TA150273

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-timR/Ldr(toxin)
• Location: 5080444..5080666
• Replicon: chromosome
• Accession: NZ_CP048934
• Organism: Escherichia coli strain 190693

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: D3H2K1
• Locus tag: G5C00_RS24340
• Protein ID: WP_000170955.1
• Coordinates: 5080444..5080551 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	timR
Locus tag	-
Coordinates	5080599..5080666 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
G5C00_RS24310	5076125..5076958	+	834	WP_000456570.1	peptide chain release factor N(5)-glutamine methyltransferase	-
G5C00_RS24315	5076955..5077347	+	393	WP_000200377.1	invasion regulator SirB2	-
G5C00_RS24320	5077351..5078160	+	810	WP_001257044.1	invasion regulator SirB1	-
G5C00_RS24325	5078196..5079050	+	855	WP_000811065.1	3-deoxy-8-phosphooctulonate synthase	-
G5C00_RS24330	5079245..5079703	+	459	WP_000526135.1	IS200/IS605 family transposase	-
G5C00_RS24335	5079909..5080016	-	108	WP_000176713.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	5080064..5080130	+	67	NuclAT_30	-	-
-	5080064..5080130	+	67	NuclAT_30	-	-
-	5080064..5080130	+	67	NuclAT_30	-	-
-	5080064..5080130	+	67	NuclAT_30	-	-
-	5080064..5080130	+	67	NuclAT_34	-	-
-	5080064..5080130	+	67	NuclAT_34	-	-
-	5080064..5080130	+	67	NuclAT_34	-	-
-	5080064..5080130	+	67	NuclAT_34	-	-
-	5080064..5080130	+	67	NuclAT_38	-	-
-	5080064..5080130	+	67	NuclAT_38	-	-
-	5080064..5080130	+	67	NuclAT_38	-	-
-	5080064..5080130	+	67	NuclAT_38	-	-
-	5080064..5080130	+	67	NuclAT_42	-	-
-	5080064..5080130	+	67	NuclAT_42	-	-
-	5080064..5080130	+	67	NuclAT_42	-	-
-	5080064..5080130	+	67	NuclAT_42	-	-
-	5080064..5080130	+	67	NuclAT_43	-	-
-	5080064..5080130	+	67	NuclAT_43	-	-
-	5080064..5080130	+	67	NuclAT_43	-	-
-	5080064..5080130	+	67	NuclAT_43	-	-
-	5080066..5080131	+	66	NuclAT_12	-	-
-	5080066..5080131	+	66	NuclAT_12	-	-
-	5080066..5080131	+	66	NuclAT_12	-	-
-	5080066..5080131	+	66	NuclAT_12	-	-
-	5080066..5080131	+	66	NuclAT_14	-	-
-	5080066..5080131	+	66	NuclAT_14	-	-
-	5080066..5080131	+	66	NuclAT_14	-	-
-	5080066..5080131	+	66	NuclAT_14	-	-
-	5080066..5080131	+	66	NuclAT_16	-	-
-	5080066..5080131	+	66	NuclAT_16	-	-
-	5080066..5080131	+	66	NuclAT_16	-	-
-	5080066..5080131	+	66	NuclAT_16	-	-
-	5080066..5080131	+	66	NuclAT_18	-	-
-	5080066..5080131	+	66	NuclAT_18	-	-
-	5080066..5080131	+	66	NuclAT_18	-	-
-	5080066..5080131	+	66	NuclAT_18	-	-
-	5080066..5080131	+	66	NuclAT_20	-	-
-	5080066..5080131	+	66	NuclAT_20	-	-
-	5080066..5080131	+	66	NuclAT_20	-	-
-	5080066..5080131	+	66	NuclAT_20	-	-
-	5080066..5080131	+	66	NuclAT_22	-	-
-	5080066..5080131	+	66	NuclAT_22	-	-
-	5080066..5080131	+	66	NuclAT_22	-	-
-	5080066..5080131	+	66	NuclAT_22	-	-
G5C00_RS24340	5080444..5080551	-	108	WP_000170955.1	small toxic polypeptide LdrA/LdrC	Toxin
-	5080599..5080666	+	68	NuclAT_11	-	Antitoxin
-	5080599..5080666	+	68	NuclAT_11	-	Antitoxin
-	5080599..5080666	+	68	NuclAT_11	-	Antitoxin
-	5080599..5080666	+	68	NuclAT_11	-	Antitoxin
-	5080599..5080666	+	68	NuclAT_13	-	Antitoxin
-	5080599..5080666	+	68	NuclAT_13	-	Antitoxin
-	5080599..5080666	+	68	NuclAT_13	-	Antitoxin
-	5080599..5080666	+	68	NuclAT_13	-	Antitoxin
-	5080599..5080666	+	68	NuclAT_15	-	Antitoxin
-	5080599..5080666	+	68	NuclAT_15	-	Antitoxin
-	5080599..5080666	+	68	NuclAT_15	-	Antitoxin
-	5080599..5080666	+	68	NuclAT_15	-	Antitoxin
-	5080599..5080666	+	68	NuclAT_17	-	Antitoxin
-	5080599..5080666	+	68	NuclAT_17	-	Antitoxin
-	5080599..5080666	+	68	NuclAT_17	-	Antitoxin
-	5080599..5080666	+	68	NuclAT_17	-	Antitoxin
-	5080599..5080666	+	68	NuclAT_19	-	Antitoxin
-	5080599..5080666	+	68	NuclAT_19	-	Antitoxin
-	5080599..5080666	+	68	NuclAT_19	-	Antitoxin
-	5080599..5080666	+	68	NuclAT_19	-	Antitoxin
-	5080599..5080666	+	68	NuclAT_21	-	Antitoxin
-	5080599..5080666	+	68	NuclAT_21	-	Antitoxin
-	5080599..5080666	+	68	NuclAT_21	-	Antitoxin
-	5080599..5080666	+	68	NuclAT_21	-	Antitoxin
G5C00_RS24345	5080956..5082056	-	1101	WP_001309461.1	sodium-potassium/proton antiporter ChaA	-
G5C00_RS24350	5082326..5082556	+	231	WP_001146444.1	putative cation transport regulator ChaB	-
G5C00_RS24355	5082714..5083409	+	696	WP_001295621.1	glutathione-specific gamma-glutamylcyclotransferase	-
G5C00_RS24360	5083453..5083806	-	354	WP_001169669.1	DsrE/F sulfur relay family protein YchN	-
G5C00_RS24365	5083992..5085386	+	1395	WP_001718153.1	inverse autotransporter invasin YchO	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	flank	IS/Tn	-	-	5079245..5079703	458

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 4013.82 Da
• Isoelectric Point: 11.4779

>T150273 WP_000170955.1 NZ_CP048934:c5080551-5080444 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK

Nucleotide

• Length: 108 bp

>T150273 NZ_CP064663:840134-840547 [Salmonella sp. SJTUF14170]
GTGGTCCTGTGGCAATCTGATTTACGCGTCTCATGGCGCGCTCAGTGGATCTCATTGCTCATTCATGGGCTGGTTGCCGC
GGTGATTTTATTGATGCCCTGGCCGCTGAGTTATACCCCGTTATGGATGATACTACTGTCGCTGGTCGTGTTTGACTGTG
TACGTAGCCAGCGCAGGATTAATACCTGTCAGGGAGAGATCAAGCTACTCATGGACGGGCGCTTACGCTGGCAGGGGCAG
GACTGGACGCTCTTGCATCCGCCCTGGTTACTGAAGAGCGGGATGGTGTTGCGTTTACGCGCAGAGTCTGGACGTCATCA
GCATTTATGGCTGGCGGCGGATAGCATGGAAGAAGCGGAATGGCGTGAGTTGCGTCGGATACTGTTACAGCAGCCGATAT
CAGGCCAACACTGA

Antitoxin

Nucleotide

• Length: 68 bp

>AT150273 NZ_CP048934:5080599-5080666 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Structures

Toxin

• AlphaFold DB: A0A829J2A9

Antitoxin