Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 64637..64901 | Replicon | plasmid pEcQE11-421-3 |
| Accession | NZ_CP048824 | ||
| Organism | Escherichia coli strain QEC11-421 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | E6BRV3 |
| Locus tag | QE11421_RS24210 | Protein ID | WP_001303307.1 |
| Coordinates | 64749..64901 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 64637..64699 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QE11421_RS24195 | 60739..61809 | - | 1071 | WP_000151582.1 | IncI1-type conjugal transfer protein TrbB | - |
| QE11421_RS24200 | 61828..63036 | - | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
| - | 63216..63276 | - | 61 | NuclAT_1 | - | - |
| - | 63216..63276 | - | 61 | NuclAT_1 | - | - |
| - | 63216..63276 | - | 61 | NuclAT_1 | - | - |
| - | 63216..63276 | - | 61 | NuclAT_1 | - | - |
| QE11421_RS24205 | 63343..64434 | - | 1092 | WP_000426061.1 | hypothetical protein | - |
| - | 64637..64699 | - | 63 | NuclAT_0 | - | Antitoxin |
| - | 64637..64699 | - | 63 | NuclAT_0 | - | Antitoxin |
| - | 64637..64699 | - | 63 | NuclAT_0 | - | Antitoxin |
| - | 64637..64699 | - | 63 | NuclAT_0 | - | Antitoxin |
| QE11421_RS24210 | 64749..64901 | + | 153 | WP_001303307.1 | Hok/Gef family protein | Toxin |
| QE11421_RS24215 | 64973..65224 | - | 252 | WP_001291965.1 | hypothetical protein | - |
| - | 65611..65662 | - | 52 | NuclAT_2 | - | - |
| - | 65611..65662 | - | 52 | NuclAT_2 | - | - |
| - | 65611..65662 | - | 52 | NuclAT_2 | - | - |
| - | 65611..65662 | - | 52 | NuclAT_2 | - | - |
| QE11421_RS24220 | 66148..66324 | - | 177 | WP_001054900.1 | hypothetical protein | - |
| QE11421_RS24225 | 66533..66742 | - | 210 | Protein_71 | hemolysin expression modulator Hha | - |
| QE11421_RS24230 | 66840..67454 | - | 615 | WP_000578649.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| QE11421_RS24235 | 67530..69698 | - | 2169 | WP_199266157.1 | DotA/TraY family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aph(6)-Id / aph(3'')-Ib | - | 1..110687 | 110687 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.21 Da Isoelectric Point: 8.7948
>T150087 WP_001303307.1 NZ_CP048824:64749-64901 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T150087 NZ_CP064387:2280982-2281200 [Escherichia coli O104:H4]
ATGTCCGAAAAACCTTTAACGAAAACCGATTATTTAATGCGTTTACGTCGTTGCCAGACAATTGACACGCTGGAGCGTGT
TATCGAGAAAAATAAATACGAATTATCAGATAATGAACTGGCGGTATTTTACTCAGCCGCAGATCACCGCCTCGCCGAAT
TGACCATGAATAAACTATACGACAAGATCCCTTCCTCAGTATGGAAATTTATTCGCTAA
ATGTCCGAAAAACCTTTAACGAAAACCGATTATTTAATGCGTTTACGTCGTTGCCAGACAATTGACACGCTGGAGCGTGT
TATCGAGAAAAATAAATACGAATTATCAGATAATGAACTGGCGGTATTTTACTCAGCCGCAGATCACCGCCTCGCCGAAT
TGACCATGAATAAACTATACGACAAGATCCCTTCCTCAGTATGGAAATTTATTCGCTAA
Antitoxin
Download Length: 63 bp
>AT150087 NZ_CP048824:c64699-64637 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|