Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF3/- |
| Location | 2283252..2283551 | Replicon | chromosome |
| Accession | NZ_CP048643 | ||
| Organism | Staphylococcus aureus strain SR153 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | A0A4U0AGH1 |
| Locus tag | GAU34_RS11300 | Protein ID | WP_072482930.1 |
| Coordinates | 2283375..2283551 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF3 | ||
| Locus tag | - | ||
| Coordinates | 2283252..2283307 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GAU34_RS11260 | 2278809..2278988 | + | 180 | WP_000669789.1 | hypothetical protein | - |
| GAU34_RS11265 | 2279299..2279559 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| GAU34_RS11270 | 2279612..2279962 | - | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
| GAU34_RS11275 | 2280472..2280807 | - | 336 | Protein_2187 | SH3 domain-containing protein | - |
| GAU34_RS11280 | 2281460..2281951 | - | 492 | WP_000920041.1 | staphylokinase | - |
| GAU34_RS11285 | 2282142..2282897 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| GAU34_RS11290 | 2282909..2283163 | - | 255 | WP_000611512.1 | phage holin | - |
| GAU34_RS11295 | 2283215..2283322 | + | 108 | Protein_2191 | hypothetical protein | - |
| - | 2283244..2283383 | + | 140 | NuclAT_0 | - | - |
| - | 2283244..2283383 | + | 140 | NuclAT_0 | - | - |
| - | 2283244..2283383 | + | 140 | NuclAT_0 | - | - |
| - | 2283244..2283383 | + | 140 | NuclAT_0 | - | - |
| - | 2283252..2283307 | + | 56 | - | - | Antitoxin |
| GAU34_RS11300 | 2283375..2283551 | - | 177 | WP_072482930.1 | putative holin-like toxin | Toxin |
| GAU34_RS11305 | 2283659..2284432 | - | 774 | WP_000750412.1 | staphylococcal enterotoxin type A | - |
| GAU34_RS11310 | 2284805..2285179 | - | 375 | WP_000340977.1 | hypothetical protein | - |
| GAU34_RS11315 | 2285235..2285522 | - | 288 | WP_001262621.1 | hypothetical protein | - |
| GAU34_RS11320 | 2285568..2285720 | - | 153 | WP_001000058.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | scn / sak / sea / hlb / sell / sec / tsst-1 | 2279612..2347305 | 67693 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6883.46 Da Isoelectric Point: 10.6777
>T149809 WP_072482930.1 NZ_CP048643:c2283551-2283375 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIAFIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIAFIGLVIKLIELSNKK
Download Length: 177 bp
>T149809 NZ_CP064252:2038038-2038140 [Klebsiella pneumoniae]
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
Antitoxin
Download Length: 56 bp
>AT149809 NZ_CP048643:2283252-2283307 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|