Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 46084..46323 | Replicon | plasmid p38_A-OXA140 |
Accession | NZ_CP048377 | ||
Organism | Escherichia coli strain 38 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | A0A762TWR7 |
Locus tag | GZS06_RS22965 | Protein ID | WP_023144756.1 |
Coordinates | 46084..46218 (-) | Length | 45 a.a. |
Antitoxin (RNA)
Gene name | srnC | ||
Locus tag | - | ||
Coordinates | 46263..46323 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GZS06_RS22935 | 41343..42040 | - | 698 | Protein_52 | IS6 family transposase | - |
GZS06_RS22940 | 42067..42650 | - | 584 | Protein_53 | incFII family plasmid replication initiator RepA | - |
GZS06_RS22945 | 42643..42717 | - | 75 | WP_031943482.1 | RepA leader peptide Tap | - |
GZS06_RS23350 | 42714..42848 | - | 135 | Protein_55 | protein CopA/IncA | - |
GZS06_RS22950 | 43079..44613 | + | 1535 | Protein_56 | IS21 family transposase | - |
GZS06_RS22955 | 44628..45373 | + | 746 | Protein_57 | IS21-like element ISEc12 family helper ATPase IstB | - |
GZS06_RS22960 | 45533..45787 | - | 255 | WP_000083850.1 | replication regulatory protein RepA | - |
GZS06_RS22965 | 46084..46218 | - | 135 | WP_023144756.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 46263..46323 | + | 61 | NuclAT_0 | - | Antitoxin |
- | 46263..46323 | + | 61 | NuclAT_0 | - | Antitoxin |
- | 46263..46323 | + | 61 | NuclAT_0 | - | Antitoxin |
- | 46263..46323 | + | 61 | NuclAT_0 | - | Antitoxin |
GZS06_RS22970 | 46290..46576 | - | 287 | Protein_60 | DUF2726 domain-containing protein | - |
GZS06_RS22975 | 47089..47301 | - | 213 | WP_013023861.1 | hypothetical protein | - |
GZS06_RS22980 | 47432..47992 | - | 561 | WP_000139341.1 | fertility inhibition protein FinO | - |
GZS06_RS22985 | 48047..48619 | - | 573 | Protein_63 | type-F conjugative transfer system pilin acetylase TraX | - |
GZS06_RS22990 | 48658..49716 | - | 1059 | Protein_64 | DUF3560 domain-containing protein | - |
GZS06_RS22995 | 49768..49998 | - | 231 | WP_000218642.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | tet(B) / sul1 / qacE / aadA5 / blaNDM-5 / aadA2 / dfrA12 / blaTEM-1B / aac(6')-Ib-cr / blaOXA-1 / blaCTX-M-15 | - | 1..86996 | 86996 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T149298 WP_023144756.1 NZ_CP048377:c46218-46084 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
>T149298 NZ_CP063992:c4168526-4168424 [Klebsiella pneumoniae]
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
Antitoxin
Download Length: 61 bp
>AT149298 NZ_CP048377:46263-46323 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|