Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 66205..66469 | Replicon | plasmid pC-F-163_B |
| Accession | NZ_CP048373 | ||
| Organism | Escherichia coli strain 163 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Z417 |
| Locus tag | GZS08_RS23845 | Protein ID | WP_001387489.1 |
| Coordinates | 66205..66357 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 66409..66469 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GZS08_RS23810 | 61770..61886 | + | 117 | Protein_68 | IncI1-type conjugal transfer lipoprotein TraH | - |
| GZS08_RS23815 | 61885..63639 | + | 1755 | Protein_69 | DotA/TraY family protein | - |
| GZS08_RS23820 | 63710..64372 | + | 663 | WP_000644796.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| GZS08_RS23825 | 64444..64653 | - | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| GZS08_RS23830 | 65045..65221 | + | 177 | WP_001054897.1 | hypothetical protein | - |
| GZS08_RS23835 | 65286..65582 | - | 297 | WP_011264046.1 | hypothetical protein | - |
| GZS08_RS23840 | 65882..66133 | + | 252 | WP_001291964.1 | hypothetical protein | - |
| GZS08_RS23845 | 66205..66357 | - | 153 | WP_001387489.1 | Hok/Gef family protein | Toxin |
| - | 66409..66469 | + | 61 | NuclAT_0 | - | Antitoxin |
| - | 66409..66469 | + | 61 | NuclAT_0 | - | Antitoxin |
| - | 66409..66469 | + | 61 | NuclAT_0 | - | Antitoxin |
| - | 66409..66469 | + | 61 | NuclAT_0 | - | Antitoxin |
| GZS08_RS23850 | 66672..67019 | + | 348 | Protein_76 | protein finQ | - |
| GZS08_RS23855 | 67205..68362 | + | 1158 | Protein_77 | IS1380-like element ISEc9 family transposase | - |
| GZS08_RS23860 | 68418..69115 | + | 698 | Protein_78 | IS1 family transposase | - |
| GZS08_RS23865 | 69129..69434 | - | 306 | Protein_79 | transcription termination factor NusG | - |
| GZS08_RS23870 | 69876..70163 | - | 288 | WP_000074855.1 | conjugal transfer protein TraA | - |
| GZS08_RS23875 | 70081..70344 | - | 264 | WP_032180564.1 | ash family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCMY-42 | - | 1..71270 | 71270 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5761.10 Da Isoelectric Point: 8.7948
>T149273 WP_001387489.1 NZ_CP048373:c66357-66205 [Escherichia coli]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T149273 NZ_CP063983:2220361-2220463 [Escherichia coli]
GCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTGTTCGGTCTCTTTTT
GCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTGTTCGGTCTCTTTTT
Antitoxin
Download Length: 61 bp
>AT149273 NZ_CP048373:66409-66469 [Escherichia coli]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|