Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 287..47485 | Replicon | plasmid p142_C |
| Accession | NZ_CP048340 | ||
| Organism | Escherichia coli strain 142 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A4Q6IVD3 |
| Locus tag | GZS12_RS25600 | Protein ID | WP_004105250.1 |
| Coordinates | 47485..287 (+) | Length | -15732.333333333 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | GZS12_RS25605 | Protein ID | WP_001673379.1 |
| Coordinates | 287..586 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GZS12_RS25605 | 287..586 | + | 300 | WP_001673379.1 | XRE family transcriptional regulator | Antitoxin |
| GZS12_RS25610 | 620..904 | - | 285 | WP_001673380.1 | hypothetical protein | - |
| GZS12_RS25615 | 1172..1552 | + | 381 | WP_000061763.1 | hypothetical protein | - |
| GZS12_RS25620 | 1616..1889 | + | 274 | Protein_4 | helix-turn-helix domain-containing protein | - |
| GZS12_RS25625 | 2500..2688 | + | 189 | WP_004105254.1 | hypothetical protein | - |
| GZS12_RS25630 | 2699..3898 | - | 1200 | WP_004105256.1 | ORF6N domain-containing protein | - |
| GZS12_RS25635 | 3895..4086 | - | 192 | WP_004105259.1 | hypothetical protein | - |
| GZS12_RS25640 | 4164..4337 | - | 174 | WP_157838146.1 | ash family protein | - |
| GZS12_RS25645 | 5214..5462 | - | 249 | WP_000730008.1 | hypothetical protein | - |
| GZS12_RS25650 | 5506..6159 | - | 654 | WP_000156167.1 | ParA family protein | - |
| GZS12_RS25655 | 6310..6684 | - | 375 | WP_004105266.1 | hypothetical protein | - |
| GZS12_RS25660 | 6777..7433 | - | 657 | WP_000839976.1 | helix-turn-helix domain-containing protein | - |
| GZS12_RS25665 | 7608..8102 | + | 495 | WP_004105269.1 | hypothetical protein | - |
| GZS12_RS25670 | 8099..8614 | + | 516 | WP_001523092.1 | hypothetical protein | - |
| GZS12_RS25675 | 8611..8844 | + | 234 | WP_000100624.1 | hypothetical protein | - |
| GZS12_RS25680 | 8844..9248 | + | 405 | WP_001014473.1 | hypothetical protein | - |
| GZS12_RS25685 | 9245..9577 | + | 333 | WP_001270825.1 | DUF1064 domain-containing protein | - |
| GZS12_RS25690 | 9581..9958 | + | 378 | WP_001250512.1 | hypothetical protein | - |
| GZS12_RS25695 | 10128..11195 | + | 1068 | WP_001705004.1 | DUF3560 domain-containing protein | - |
| GZS12_RS25700 | 11273..11554 | + | 282 | WP_000823235.1 | hypothetical protein | - |
| GZS12_RS25705 | 11551..11916 | + | 366 | WP_004105278.1 | hypothetical protein | - |
| GZS12_RS25710 | 11946..12104 | + | 159 | WP_001706266.1 | hypothetical protein | - |
| GZS12_RS25715 | 12101..12712 | + | 612 | WP_004105282.1 | hypothetical protein | - |
| GZS12_RS25720 | 12715..13059 | + | 345 | WP_001705006.1 | hypothetical protein | - |
| GZS12_RS25725 | 13052..13768 | + | 717 | WP_023908961.1 | ead/Ea22-like family protein | - |
| GZS12_RS25730 | 14147..14542 | + | 396 | WP_001271967.1 | phage holin family protein | - |
| GZS12_RS25735 | 14529..14825 | + | 297 | WP_000254764.1 | phage holin family protein | - |
| GZS12_RS25740 | 14809..15354 | + | 546 | WP_024180651.1 | glycoside hydrolase family 108 protein | - |
| GZS12_RS25745 | 15351..15629 | + | 279 | WP_023908959.1 | hypothetical protein | - |
| GZS12_RS25755 | 16307..16893 | + | 587 | Protein_30 | S-adenosylmethionine-binding protein | - |
| GZS12_RS25760 | 17005..17274 | + | 270 | WP_000867916.1 | hypothetical protein | - |
| GZS12_RS25765 | 17274..17471 | + | 198 | WP_001222808.1 | hypothetical protein | - |
| GZS12_RS25770 | 17546..17845 | + | 300 | WP_033550356.1 | hypothetical protein | - |
| GZS12_RS26135 | 18032..18184 | + | 153 | WP_004105298.1 | hypothetical protein | - |
| GZS12_RS25775 | 18233..18643 | + | 411 | Protein_35 | hypothetical protein | - |
| GZS12_RS25780 | 18878..19501 | + | 624 | WP_023908957.1 | ParB/Srx family N-terminal domain-containing protein | - |
| GZS12_RS25785 | 19501..20874 | + | 1374 | WP_004105305.1 | ParB N-terminal domain-containing protein | - |
| GZS12_RS25790 | 20915..21610 | + | 696 | WP_001705017.1 | hypothetical protein | - |
| GZS12_RS25795 | 22168..22758 | + | 591 | WP_001185429.1 | ParB/Srx family N-terminal domain-containing protein | - |
| GZS12_RS25800 | 22758..23309 | + | 552 | WP_001019009.1 | hypothetical protein | - |
| GZS12_RS25805 | 23315..25171 | + | 1857 | WP_001406385.1 | phage terminase large subunit family protein | - |
| GZS12_RS25810 | 25183..25422 | + | 240 | WP_001058287.1 | hypothetical protein | - |
| GZS12_RS25815 | 25419..26993 | + | 1575 | WP_001022885.1 | phage portal protein | - |
| GZS12_RS25820 | 26986..28050 | + | 1065 | WP_004105315.1 | Clp protease ClpP | - |
| GZS12_RS25825 | 28060..28443 | + | 384 | WP_004105317.1 | bacteriophage lambda head decoration D family protein | - |
| GZS12_RS25830 | 28464..29507 | + | 1044 | WP_004105318.1 | major capsid protein | - |
| GZS12_RS25835 | 29508..29900 | + | 393 | WP_001523066.1 | hypothetical protein | - |
| GZS12_RS25840 | 29900..30244 | + | 345 | WP_004105322.1 | ATP-binding sugar transporter from pro-phage family protein | - |
| GZS12_RS25845 | 30241..30726 | + | 486 | WP_000609134.1 | hypothetical protein | - |
| GZS12_RS25850 | 30727..31017 | + | 291 | WP_001284546.1 | hypothetical protein | - |
| GZS12_RS25855 | 31017..32480 | + | 1464 | WP_115786624.1 | phage tail sheath family protein | - |
| GZS12_RS25860 | 32497..33018 | + | 522 | WP_004105328.1 | phage major tail tube protein | - |
| GZS12_RS25865 | 33028..33309 | + | 282 | WP_000450805.1 | phage tail assembly protein | - |
| GZS12_RS25870 | 33464..36256 | + | 2793 | WP_001523070.1 | phage tail tape measure protein | - |
| GZS12_RS25875 | 36457..37458 | + | 1002 | WP_004105332.1 | phage late control D family protein | - |
| GZS12_RS25880 | 37461..38081 | + | 621 | WP_001523073.1 | phage baseplate assembly protein V | - |
| GZS12_RS25885 | 38078..38545 | + | 468 | WP_000635200.1 | phage tail protein | - |
| GZS12_RS25890 | 38542..38862 | + | 321 | WP_001523074.1 | hypothetical protein | - |
| GZS12_RS25895 | 38859..39983 | + | 1125 | WP_001705026.1 | baseplate J/gp47 family protein | - |
| GZS12_RS25900 | 39976..40557 | + | 582 | WP_023908964.1 | phage tail protein I | - |
| GZS12_RS25905 | 40588..43434 | + | 2847 | WP_039052398.1 | tail fiber protein | - |
| GZS12_RS25910 | 43434..44051 | + | 618 | WP_001523080.1 | tail fiber assembly protein | - |
| GZS12_RS25915 | 44015..44560 | - | 546 | WP_001704996.1 | transferase | - |
| GZS12_RS25920 | 45186..46022 | + | 837 | WP_024171747.1 | replication initiator protein RepA | - |
| GZS12_RS25925 | 46666..46953 | + | 288 | WP_000356589.1 | hypothetical protein | - |
| GZS12_RS25930 | 46977..47240 | + | 264 | WP_000424604.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..47545 | 47545 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: -15732.333333333 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T149142 WP_004105250.1 NZ_CP048340:47485-287 [Escherichia coli]
Download Length: -47197 bp
>T149142 NZ_CP063933:c2434262-2433852 [Klebsiella variicola]
GTGGTCCTGTGGCAATCTGATCTCCGTATCTCCTGGCGCGCGCAGTGGTTTTCCCTGCTGCTCCACGGCGTTGTGGCGGC
GCTGGTGCTGTTGGTTCCCTGGCCGCTAAGCTACACCCCGATCTGGCTGCTGCTGTTGTCGCTGGTAGTGTTTGACTGCG
TGCGCAGCCAGCGGCGGATCCATGCCCGTCGCGGAGAGATAAAACTGCTCACCGATTCCCGTCTTCGCTGGCAAAACGCC
GAATGGGAGATCCTCGGGACGCCGTGGGTCATCAATAGCGGTATGCTGCTGCGTTTACGCCATGTCGATACCCGGCGCGG
GCAGCATCTGTGGCTGGCGGCGGATAGCATGGATGCCGGAGAATGGCGCGATCTGCGCCGGCTGGTGCTGCAAAAACCGG
CGCAGGAGTAA
GTGGTCCTGTGGCAATCTGATCTCCGTATCTCCTGGCGCGCGCAGTGGTTTTCCCTGCTGCTCCACGGCGTTGTGGCGGC
GCTGGTGCTGTTGGTTCCCTGGCCGCTAAGCTACACCCCGATCTGGCTGCTGCTGTTGTCGCTGGTAGTGTTTGACTGCG
TGCGCAGCCAGCGGCGGATCCATGCCCGTCGCGGAGAGATAAAACTGCTCACCGATTCCCGTCTTCGCTGGCAAAACGCC
GAATGGGAGATCCTCGGGACGCCGTGGGTCATCAATAGCGGTATGCTGCTGCGTTTACGCCATGTCGATACCCGGCGCGG
GCAGCATCTGTGGCTGGCGGCGGATAGCATGGATGCCGGAGAATGGCGCGATCTGCGCCGGCTGGTGCTGCAAAAACCGG
CGCAGGAGTAA
Antitoxin
Download Length: 100 a.a. Molecular weight: 11069.90 Da Isoelectric Point: 5.8899
>AT149142 WP_001673379.1 NZ_CP048340:287-586 [Escherichia coli]
MRTLDEVIASRSPESQARIKEMADEMILEVGLQMMREELQLSQKQVAEAMGISQPAVTKLEQRGNDLKLATLKRYVEAMG
GKLSLDVELPTGKRVAFHV
MRTLDEVIASRSPESQARIKEMADEMILEVGLQMMREELQLSQKQVAEAMGISQPAVTKLEQRGNDLKLATLKRYVEAMG
GKLSLDVELPTGKRVAFHV
Download Length: 300 bp
>AT149142 NZ_CP063933:c2434509-2434243 [Klebsiella variicola]
ATGGACATTAACAATAAAGCACGTATCCACTGGGCATGCCGCCGCGGGATGCGCGAACTCGACATCTCCATCATGCCGTT
CTTTGAGTATGAGTACGATACCCTCAGCGACGCTGACAAACAGCTGTTCATTCGCCTGCTGGAAAATGACGATCCGGATC
TGTTCAACTGGCTGATGAACCACGGCAAACCGGCCGATGCGGAGCTGCAGCGGATGGTAACCTTAATTCAGACACGGAAT
CGGGAACGTGGTCCTGTGGCAATCTGA
ATGGACATTAACAATAAAGCACGTATCCACTGGGCATGCCGCCGCGGGATGCGCGAACTCGACATCTCCATCATGCCGTT
CTTTGAGTATGAGTACGATACCCTCAGCGACGCTGACAAACAGCTGTTCATTCGCCTGCTGGAAAATGACGATCCGGATC
TGTTCAACTGGCTGATGAACCACGGCAAACCGGCCGATGCGGAGCTGCAGCGGATGGTAACCTTAATTCAGACACGGAAT
CGGGAACGTGGTCCTGTGGCAATCTGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|