Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2849580..2849805 | Replicon | chromosome |
Accession | NZ_CP048107 | ||
Organism | Escherichia coli strain 201609 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | - |
Locus tag | GWK05_RS13750 | Protein ID | WP_197731663.1 |
Coordinates | 2849580..2849735 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2849747..2849805 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GWK05_RS13710 | 2845286..2845471 | - | 186 | WP_001228696.1 | prophage lysis lipoprotein RzoD | - |
GWK05_RS13715 | 2845688..2846185 | - | 498 | WP_001135296.1 | lysozyme RrrD | - |
GWK05_RS13720 | 2846185..2846400 | - | 216 | WP_001587000.1 | phage lysis protein EssD | - |
GWK05_RS13735 | 2847688..2848230 | - | 543 | WP_000640136.1 | DUF1133 family protein | - |
GWK05_RS13740 | 2848227..2848517 | - | 291 | WP_001586999.1 | DUF1364 domain-containing protein | - |
GWK05_RS13745 | 2848517..2849116 | - | 600 | WP_000940324.1 | DUF1367 family protein | - |
GWK05_RS13750 | 2849580..2849735 | - | 156 | WP_197731663.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 2849747..2849805 | + | 59 | - | - | Antitoxin |
GWK05_RS13755 | 2850065..2851123 | + | 1059 | WP_001586997.1 | nucleoid-associated protein | - |
GWK05_RS13760 | 2851095..2852528 | + | 1434 | WP_001586996.1 | hypothetical protein | - |
GWK05_RS13765 | 2852559..2853077 | - | 519 | WP_001586995.1 | hypothetical protein | - |
GWK05_RS13770 | 2853238..2853660 | - | 423 | WP_001586994.1 | DUF977 family protein | - |
GWK05_RS13775 | 2853677..2854402 | - | 726 | WP_000450652.1 | DUF1627 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2817324..2864960 | 47636 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5752.93 Da Isoelectric Point: 6.1389
>T148859 WP_197731663.1 NZ_CP048107:c2849735-2849580 [Escherichia coli]
MKQQKAMLVALIVICLTVIVTVLVTRKDLCEVRIRTDQTEVAVFTAYELGE
MKQQKAMLVALIVICLTVIVTVLVTRKDLCEVRIRTDQTEVAVFTAYELGE
Download Length: 156 bp
>T148859 NZ_CP063887:4344425-4344527 [Klebsiella quasipneumoniae]
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
Antitoxin
Download Length: 59 bp
>AT148859 NZ_CP048107:2849747-2849805 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGCAAAGCATGAAATTGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGCAAAGCATGAAATTGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|