Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 174435..174615 | Replicon | chromosome |
Accession | NZ_CP047922 | ||
Organism | Staphylococcus aureus strain SR231 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | GWG04_RS01095 | Protein ID | WP_001801861.1 |
Coordinates | 174520..174615 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 174435..174492 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GWG04_RS01065 | 170143..170277 | + | 135 | WP_001791797.1 | hypothetical protein | - |
GWG04_RS01070 | 170441..171997 | + | 1557 | WP_212563504.1 | type I restriction-modification system subunit M | - |
GWG04_RS01075 | 171990..173220 | + | 1231 | Protein_176 | restriction endonuclease subunit S | - |
GWG04_RS01080 | 173762..174172 | + | 411 | WP_001808705.1 | IS21 family transposase | - |
GWG04_RS01085 | 174157..174318 | + | 162 | Protein_178 | transposase | - |
GWG04_RS01090 | 174296..174397 | - | 102 | WP_001792025.1 | hypothetical protein | - |
- | 174435..174492 | + | 58 | - | - | Antitoxin |
GWG04_RS01095 | 174520..174615 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
GWG04_RS01100 | 174760..175772 | + | 1013 | Protein_181 | IS3 family transposase | - |
GWG04_RS01105 | 175970..176542 | - | 573 | WP_000414216.1 | hypothetical protein | - |
GWG04_RS01110 | 176643..176984 | - | 342 | WP_000627540.1 | DUF3969 family protein | - |
GWG04_RS01115 | 177025..177651 | - | 627 | WP_000669024.1 | hypothetical protein | - |
GWG04_RS01120 | 177726..178721 | - | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
GWG04_RS01125 | 178802..179452 | - | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | selk / hlgA / lukD | 132288..179416 | 47128 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T148503 WP_001801861.1 NZ_CP047922:c174615-174520 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T148503 NZ_CP063759:4281010-4281228 [Klebsiella pneumoniae]
ATGTCTGATAAGCCATTAACTAAAACAGACTATTTGATGCGCTTACGTCGTTGCCAGACAATTGACACGCTGGAGCGCGT
CATTGAAAAAAATAAATATGAACTGTCTGATAATGAGCTGGCGGTATTTTACTCAGCTGCCGACCATCGTCTGGCGGAAC
TGACCATGAATAAGCTATACGATAAAATCCCGACTTCTGTCTGGAAATTTATCCGCTAA
ATGTCTGATAAGCCATTAACTAAAACAGACTATTTGATGCGCTTACGTCGTTGCCAGACAATTGACACGCTGGAGCGCGT
CATTGAAAAAAATAAATATGAACTGTCTGATAATGAGCTGGCGGTATTTTACTCAGCTGCCGACCATCGTCTGGCGGAAC
TGACCATGAATAAGCTATACGATAAAATCCCGACTTCTGTCTGGAAATTTATCCGCTAA
Antitoxin
Download Length: 58 bp
>AT148503 NZ_CP047922:174435-174492 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|